Dbfetch

ID   GQ376196; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   GQ376196;
XX
DT   30-JUL-2009 (Rel. 101, Created)
DT   30-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*0102 new allele, exon
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Shan X., He X., Li W., Wang L., Liu N., Wang L., Cui S., Ni L., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Shan X., He X., Li W., Wang L., Liu N., Wang L., Cui S., Ni L., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   ;
RL   Submitted (25-JUN-2009) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; ac6965f8b84049b4c19bb5d7d180c634.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0102 new"
FT   mRNA            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0102 new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0102 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C7FGZ4"
FT                   /db_xref="IMGT/HLA:C*01:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C7FGZ4"
FT                   /protein_id="ACT68330.1"
FT                   /translation="SHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGTCVECLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0102 new"
FT                   /number=3
FT   variation       230
FT                   /gene="HLA-C"
FT                   /replace="g"
XX
SQ   Sequence 276 BP; 51 A; 88 C; 101 G; 36 T; 0 other;
     ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgt ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//