Dbfetch

ID   GQ374478; SV 1; linear; genomic DNA; STD; HUM; 942 BP.
XX
AC   GQ374478;
XX
DT   14-AUG-2011 (Rel. 109, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens clone 8203 MHC class I antigen (HLA-G) gene, HLA-G*01:17
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-942
RX   DOI; 10.1016/j.humimm.2010.12.003.
RX   PUBMED; 21156191.
RA   Czarnecki C., Van Domselaar G., Embree J., Brunham R., Plummer F.A.,
RA   Luo M.;
RT   "Identification of HLA-G*01:17, a new allele possibly generated by an
RT   interloci gene conversion event involving exon 3 of HLA-B";
RL   Hum. Immunol. 72(3):238-240(2011).
XX
RN   [2]
RP   1-942
RA   Czarnecki C.K., Luo M., Brunham R.C., Embree J.E., Plummer F.A.;
RT   "Identification of a novel HLA-G allele in an East African Cohort";
RL   Unpublished.
XX
RN   [3]
RP   1-942
RA   Czarnecki C.K., Luo M., Brunham R.C., Embree J.E., Plummer F.A.;
RT   ;
RL   Submitted (10-JUL-2009) to the INSDC.
RL   HIV and Human Genetics, National Microbiology Laboratory, 1015 Arlington
RL   Street, Winnipeg, Manitoba R3E 3R2, Canada
XX
DR   MD5; 8a2f6e77ba1a0c8b89223d6689561ed3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..942
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="8203"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>942
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01:17"
FT   mRNA            join(<80..349,576..>851)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01:17"
FT                   /product="MHC class I antigen"
FT   CDS             join(<80..349,576..>851)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01:17"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:G0T3C4"
FT                   /db_xref="IMGT/HLA:G*01:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G0T3C4"
FT                   /protein_id="ADL40397.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLRRHLENGKEMLQRA"
FT   exon            80..349
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01:17"
FT                   /number=2
FT   exon            576..851
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01:17"
FT                   /number=3
XX
SQ   Sequence 942 BP; 181 A; 309 C; 328 G; 124 T; 0 other;
     ccggcccggc gggggcgcag gacccggcag ccgcgccggg aggagggtcg ggcgggtctc        60
     aacctctcct cgcccccagg ctcccactcc atgaggtatt tcagcgccgc cgtgtcccgg       120
     cccggccgcg gggagccccg cttcatcgcc atgggctacg tggacgacac gcagttcgtg       180
     cggttcgaca gcgactcggc gtgtccgagg atggagccgc gggcgccgtg ggtggagcag       240
     gaggggccag agtattggga agaggagaca cggaacacca aggcccacgc acagactgac       300
     agaatgaacc tgcagaccct gcgcggctac tacaaccaga gcgaggccag tgagtaaccc       360
     cggcccaggg cgcagatcac gaccccccac ctccatgccc cacggacgcc ccgggtactc       420
     ccgagtctcc gggtctggga tccaccccga ggccgcggga cccgcccaga ccctctacct       480
     gggagaaccc caggcgcctt taccaaaatc cctgcgggtg ggtccgggcg agggcgaggc       540
     tcggtgggcg gggctgaccg aaggggtggg gccaggttct cataccctcc agtggatgat       600
     tggctgcgac ctggggtccg acggacgcct cctccgcggg tatgaacagt atgcctacga       660
     tggcaaggat tacctcgccc tgaacgagga cctgcgctcc tggaccgcag cggacactgc       720
     ggctcagatc tccaagcgca agtgtgaggc ggccaatgtg gctgaacaaa ggagagccta       780
     cctggagggc acgtgcgtgg agtggctccg cagacacctg gagaacggga aggagatgct       840
     gcagcgcgcg ggtaccaggg gcagtggggc gcctccctga tctcctgtag acctcccagc       900
     ctggcctagc acaaggagag gaggaaaatg ggaccaacac ca                          942
//