Dbfetch

ID   GQ374477; SV 1; linear; genomic DNA; STD; HUM; 294 BP.
XX
AC   GQ374477;
XX
DT   16-AUG-2010 (Rel. 105, Created)
DT   16-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens clone 2840 MHC class II antigen (HLA-DPA1) gene,
DE   HLA-DPA1*020107 allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-294
RX   DOI; 10.1016/j.humimm.2010.05.003.
RX   PUBMED; 20470845.
RA   Czarnecki C., Luo M., Brunham R., Broliden K., Karlsson A.C., Plummer F.A.;
RT   "Identification of HLA-DPA1*020107 in an individual of Ugandan descent";
RL   Hum. Immunol. 71(7):733-735(2010).
XX
RN   [2]
RP   1-294
RA   Czarnecki C.K., Luo M., Brunham R.C., Broliden K., Karlsson A.C.,
RA   Plummer F.A.;
RT   ;
RL   Submitted (10-JUL-2009) to the INSDC.
RL   HIV and Human Genetics, National Microbiology Laboratory, 1015 Arlington
RL   Street, Winnipeg, Manitoba R3E 3R2, Canada
XX
DR   MD5; 232b68ac76246324c5d3aa043bc2d978.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..294
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="2840"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>294
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*020107"
FT   mRNA            <16..>261
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*020107"
FT                   /product="MHC class II antigen"
FT   CDS             <16..>261
FT                   /codon_start=3
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*020107"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D9YLZ6"
FT                   /db_xref="IMGT/HLA:DPA1*02:01:07"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D9YLZ6"
FT                   /protein_id="ADL40396.1"
FT                   /translation="DHVSTYAAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEF
FT                   GRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAAN"
FT   exon            16..261
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*020107"
FT                   /number=2
XX
SQ   Sequence 294 BP; 69 A; 69 C; 71 G; 85 T; 0 other;
     actttcttta tgcagcggac catgtgtcaa cttatgccgc gtttgtacag acccatagac        60
     caacagggga gtttatgttt gaatttgatg aagatgagca gttctatgtg gatctggata       120
     aaaaggagac cgtctggcat ctggaggagt ttggccgagc cttttccttt gaggctcagg       180
     gtgggctggc taacattgct atattgaaca acaacttgaa taccttgatc cagcgttcca       240
     accacactca ggccgccaat ggtactgcct atctttgcct cttcctctgt agcc             294
//