Dbfetch

ID   GQ373166; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   GQ373166;
XX
DT   26-AUG-2009 (Rel. 101, Created)
DT   26-AUG-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*9218 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   "Novel HLA Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   ;
RL   Submitted (10-JUL-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 31877833da948d906c6c6e396fde1b35.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9218 variant"
FT   mRNA            join(<1..269,511..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9218 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..269,511..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9218 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C8C9V8"
FT                   /db_xref="IMGT/HLA:A*02:190"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C8C9V8"
FT                   /protein_id="ACU46619.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTQRKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            <1..269
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9218 variant"
FT                   /number=2
FT   gap             270..510
FT                   /estimated_length=241
FT   exon            511..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9218 variant"
FT                   /number=3
XX
SQ   Sequence 787 BP; 109 A; 162 C; 195 G; 80 T; 241 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccaccc agcgcaagtg ggaggcggcc catgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//