Dbfetch

ID   GQ373162; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ373162;
XX
DT   26-AUG-2009 (Rel. 101, Created)
DT   26-AUG-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*120201 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   "Novel HLA Class II allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   ;
RL   Submitted (10-JUL-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 6e1a9e356f63cdb129e2b66f486fe20a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C8C9V4"
FT                   /db_xref="IMGT/HLA:DRB1*12:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C8C9V4"
FT                   /protein_id="ACU46609.1"
FT                   /translation="RFLEYSTCECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 67 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtgtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//