spacer

EBI Dbfetch

ID   GQ365731; SV 1; linear; genomic DNA; STD; HUM; 910 BP.
XX
AC   GQ365731;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   17-JUL-2010 (Rel. 105, Last updated, Version 3)
XX
DE   Homo sapiens isolate QD-C186 HLA class I antigen (HLA-C) gene, HLA-Cw*0134
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-910
RX   DOI; 10.1111/j.1399-0039.2010.01456.x.
RX   PUBMED; 20149161.
RA   Miao F., Sun H., Pan N., Shen Y., Xie W., Zhang J.;
RT   "Identification of a novel HLA class I allele, HLA-Cw*0134 in a Chinese
RT   individual";
RL   Tissue Antigens 75(6):737-738(2010).
XX
RN   [2]
RP   1-910
RA   Zhang J., Xie W., Miao F., Sun H., Pan N.;
RT   ;
RL   Submitted (06-JUL-2009) to the INSDC.
RL   Department of Genetics and Developmental Biology, Southeast University
RL   Medical School, No. 87 DingJiaQiao Road, Nanjing, Jiangsu 210009, China
XX
DR   MD5; 5683a95dabac18db8f1f7f5c29645f1b.
DR   EuropePMC; PMC3187788; 21998681.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..910
FT                   /organism="Homo sapiens"
FT                   /isolate="QD-C186"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>910
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0134"
FT   mRNA            join(<85..354,601..>876)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0134"
FT                   /product="HLA class I antigen"
FT   CDS             join(<85..354,601..>876)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0134"
FT                   /product="HLA class I antigen"
FT                   /note="human leukocyte antigen"
FT                   /db_xref="GOA:C8C3Y9"
FT                   /db_xref="IMGT/HLA:C*01:34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C8C3Y9"
FT                   /protein_id="ACU86978.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            85..354
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0134"
FT                   /number=2
FT   exon            601..876
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0134"
FT                   /number=3
XX
SQ   Sequence 910 BP; 157 A; 303 C; 329 G; 121 T; 0 other;
     ggggcccgcc cggcgagggc gcaggacccg gggagccgcg cagggaggag ggtcgggcgg        60
     gtctcagccc ctcctcgccc ccaggctccc actccatgaa gtatttcttc acatccgtgt       120
     cccggcctgg ccgcggagag ccccgcttca tctcagtggg ctacgtggac gacacgcagt       180
     tcgtgcggtt cgacagcgac gccgcgagtc cgagagggga gccgcgggcg ccgtgggtgg       240
     agcaggaggg gccggagtat tgggaccggg agacacagaa gtacaagcgc caggcacaga       300
     ctgaccgagt gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt       360
     gaccccggcc cggggcgcag gtcacgaccc ctcctcatcc cccacggacg gcccgggtcg       420
     ccccaagtct cccggtctga gatccacccc gaggctgcgg aacccgccca gaccctcgac       480
     cggagagagc cccagtcacc tttacccggt ttcattttca gtttaggcca aaatccccgc       540
     gggttggtcg ggactggggc ggggctcggg ggacggggct gaccacgggg gcggggccag       600
     ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg cgcctcctcc       660
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaat gaggacctgc       720
     gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       780
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       840
     acctggagaa cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt       900
     ccccatctcc                                                              910
//


spacer
spacer