spacer

EBI Dbfetch

ID   GQ355337; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   GQ355337;
XX
DT   10-AUG-2009 (Rel. 101, Created)
DT   05-AUG-2011 (Rel. 109, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*060105 allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RX   DOI; 10.1111/j.1399-0039.2009.01385.x.
RX   PUBMED; 19845909.
RA   Endres R.O., Redman H., Marcus N.;
RT   "Identification of the HLA-Cw*0774 and DQB1*060105 alleles";
RL   Tissue Antigens 75(1):84-86(2010).
XX
RN   [2]
RP   1-652
RA   Redman H., Marcus N., Endres R.O.;
RT   ;
RL   Submitted (04-JUL-2009) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W Erie Dr, Tempe, AZ
RL   85282, USA
XX
DR   MD5; d0c634cf3e03e9375f0425075268e391.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="USA"
FT                   /isolation_source="peripheral blood"
FT                   /collection_date="19-Jun-2009"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060105"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060105"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060105"
FT                   /product="MHC class II antigen"
FT                   /note="DQ beta chain"
FT                   /db_xref="GOA:C7FF12"
FT                   /db_xref="IMGT/HLA:DQB1*06:01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C7FF12"
FT                   /protein_id="ACU00831.1"
FT                   /translation="DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060105"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060105"
FT                   /number=3
XX
SQ   Sequence 652 BP; 124 A; 155 C; 172 G; 101 T; 100 other;
     aggatttcgt gctccagttt aaggccatgt gctacttcac caatgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggaggacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggacc cgagcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacagctggc gttgtgtcca ccccccttat taggaatggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcatgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer