spacer

EBI Dbfetch

ID   GQ351696; SV 1; linear; genomic DNA; STD; HUM; 1683 BP.
XX
AC   GQ351696;
XX
DT   29-JUL-2009 (Rel. 101, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*new-XW
DE   allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1683
RX   DOI; 10.1016/j.humimm.2010.01.025.
RX   PUBMED; 20097244.
RA   Tian W., Cai J.H., Wang F., Li L.X.;
RT   "MICA polymorphism in a northern Chinese Han population: The identification
RT   of a new MICA allele, MICA*059";
RL   Hum. Immunol. 71(4):423-427(2010).
XX
RN   [2]
RP   1-1683
RA   Tian W., Cai J.H., Li L.X., Wang F.;
RT   ;
RL   Submitted (01-JUL-2009) to the INSDC.
RL   Immunogenetics Research Group, Central South University, Tongzipo Road,
RL   Changsha, Hunan 410013, P.R. China
XX
DR   MD5; 8612eff43ff9781cdabbb7e6175ae023.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1683
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1683
FT                   /gene="MICA"
FT                   /allele="MICA*new-XW"
FT   mRNA            join(<1..255,530..817,1405..>1683)
FT                   /gene="MICA"
FT                   /allele="MICA*new-XW"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..>1683)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*new-XW"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:C7FEB0"
FT                   /db_xref="IMGT/HLA:MICA*059"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C7FEB0"
FT                   /protein_id="ACT78510.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEGHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICEGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*new-XW"
FT                   /number=2
FT   variation       76
FT                   /gene="MICA"
FT                   /replace="t"
FT                   /note="results in glycine to valine substitution"
FT   gap             256..529
FT                   /estimated_length=274
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*new-XW"
FT                   /number=3
FT   gap             818..1404
FT                   /estimated_length=587
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*new-XW"
FT                   /number=4
XX
SQ   Sequence 1683 BP; 214 A; 216 C; 236 G; 156 T; 861 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacagnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnntgcccc ccatggtgaa tgtcacccgc agtgaggcct      1440
     cagagggcaa cattaccgtg acatgcaggg cttctggctt ctatccctgg aatatcacac      1500
     tgagctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc gaaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcgggaatca cagcactcac cctgtgccct      1680
     ctg                                                                    1683
//


spacer
spacer