spacer

EBI Dbfetch

ID   GQ304758; SV 2; linear; genomic DNA; STD; HUM; 2895 BP.
XX
AC   GQ304758;
XX
DT   28-JUL-2009 (Rel. 101, Created)
DT   22-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0106 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2895
RA   Zou H.-Y., Cheng L.-H., Li Z., Jing S.-Z.;
RT   "HLA-C*0106 confirmation";
RL   Unpublished.
XX
RN   [2]
RP   1-2895
RA   Zou H.-Y., Cheng L.-H., Li Z., Jing S.-Z.;
RT   ;
RL   Submitted (23-JUN-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2895
RA   Zou H.-Y., Cheng L.-H., Li Z., Jing S.-Z.;
RT   ;
RL   Submitted (18-SEP-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 707a109a70808774faabaa9f20fc9c2d.
XX
CC   On Sep 18, 2009 this sequence version replaced gi:254667433.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2895
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT   mRNA            join(<1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726,2891..>2895)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726,2891..2895)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C7EXL8"
FT                   /db_xref="IMGT/HLA:C*01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C7EXL8"
FT                   /protein_id="ACT76683.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMKYFFTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=2
FT   exon            720..995
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=3
FT   exon            1583..1858
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=4
FT   exon            1980..2099
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=5
FT   exon            2539..2571
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=6
FT   exon            2679..2726
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=7
FT   exon            2891..>2895
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0106"
FT                   /number=8
XX
SQ   Sequence 2895 BP; 542 A; 833 C; 924 G; 596 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgtgagtg cggggttggg agggaaacgg cctctgcgga gaggaacgag       120
     gtgcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgaag tatttcttca catccgtgtc       240
     ccggcctggc cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg cccgggtcgc       540
     cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg gactggggcg gggctcgggg gacggggctg accacggggg cggggccagg       720
     gtctcacacc ctccagtgga tgtgtggctg cgacctgggg cccgacgggc gcctcctccg       780
     cgggtatgac cagtacgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg       840
     ctcctggacc gccgcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgtggcggag cagcggagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1020
     cccatctccc gtagatctcc cggcatggcc tcccacgagg aggggaggaa aatgggatca      1080
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1140
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1200
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1260
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcacg ctcaatgtgt      1320
     ttgaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      1380
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      1440
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtcca      1500
     ttctcaggat ggtcacatgg gcgctgttgg agtgtcgcaa gagagataca aagtgtctga      1560
     attttctgac tcttcccgtc agaacaccca aagacacacg tgacccacca tcccgtctct      1620
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1680
     acctggcagt gggatgggga ggaccaaact caggacaccg agcttgtgga gaccaggcca      1740
     gcaggagatg gaaccttcca gaagtgggca gctgtgatgg tgccttctgg agaagagcag      1800
     agatacacgt gccatgtgca gcacgagggg ctgccggagc ccctcaccct gagatggggt      1860
     aaggaggggg atgaggggtg atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      1920
     agccgggtca gggctgaggc ttggaggtca gggcccctca ccttcccctc ctttcccaga      1980
     gccgtcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      2040
     tgtcctagct gtcctaggag ctgtggtggc tgttgtgatg tgtaggagga agagctcagg      2100
     tagggaaggg gtgaggagtg gggtctgggt tttcttgttc cactgggagt ttcaagcccc      2160
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      2220
     ctgggaccct gtgtgccagc acttactctg ttgtgaagca catgacaatg aaggacagat      2280
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      2340
     aggtccctgc taaggacaga ccttaggagg gcagttgctt cagaacccac agctgctttc      2400
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      2460
     ccaagactag gaggttcccc taagatcgca tggccctgcc tcctccctgt cccctcacag      2520
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      2580
     ggcggtgggc gtgtggagga gctcacccac cccataattc ctcttgtccc acatctcctg      2640
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      2700
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtcgggggtg      2760
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      2820
     gtgagctgtt cagagtgtca tcacttacca tgactgacct gaatttgttc atgactattg      2880
     tgttctgtag cctga                                                       2895
//


spacer
spacer