Dbfetch

ID   GQ302516; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ302516;
XX
DT   10-SEP-2009 (Rel. 102, Created)
DT   10-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Faner R., Campos E., Gil J., Ambros C., Caro P., Mongay L., Mantecon S.,
RA   Herrero M.J., Pujol R., Palou E.;
RT   "Description of a new DRB1*14 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Faner R., Campos E., Gil J., Ambros C., Caro P., Mongay L., Mantecon S.,
RA   Herrero M.J., Pujol R., Palou E.;
RT   ;
RL   Submitted (22-JUN-2009) to the INSDC.
RL   LIRAD, Banc de Sang i Teixits, Crta de Can Ruti, Badalona, Barcelona 08916,
RL   Spain
XX
DR   MD5; 65c131134a99056962d26530a1ea7fe4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /note="HLA-DRB1*1406 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C9DA78"
FT                   /db_xref="IMGT/HLA:DRB1*14:06:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C9DA78"
FT                   /protein_id="ACV51797.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 65 C; 100 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacggtg cagcggcgag                                        270
//