Dbfetch

ID   GQ292547; SV 1; linear; genomic DNA; STD; HUM; 1669 BP.
XX
AC   GQ292547;
XX
DT   03-AUG-2009 (Rel. 101, Created)
DT   03-AUG-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens isolate CS00015 MHC class I antigen (HLA-Cw) gene,
DE   HLA-Cw*040101 allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1669
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   "Novel Allele of Cw*040101 Variant Identified by Sequence-based Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-1669
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   ;
RL   Submitted (19-JUN-2009) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Department of Medicine,
RL   Cedars-Sinai Medical Center, 8723 Alden Dr. SSB-197, Los Angeles, CA 90048,
RL   USA
XX
DR   MD5; a10a80aab6f3fa61e1fbc0db5b8b38f0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1669
FT                   /organism="Homo sapiens"
FT                   /isolate="CS00015"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1669
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*040101"
FT   mRNA            join(<1..270,517..792,1394..>1669)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*040101"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1394..>1669)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*040101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*04:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C7EW72"
FT                   /protein_id="ACT83089.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*040101"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*040101"
FT                   /number=3
FT   gap             793..1393
FT                   /estimated_length=601
FT   exon            1394..1669
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*040101"
FT                   /number=4
XX
SQ   Sequence 1669 BP; 173 A; 246 C; 286 G; 117 T; 847 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     ttggctgcga cctggggccg gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnaacaccc aaagacacac gtgacccacc atcccgtctc tgaccatgag      1440
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag      1500
     tgggatgggg aggaccaaac tcaggacacc gagcttgtgg agaccaggcc agcaggagat      1560
     ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacacg      1620
     tgccatgttc agcacgaggg gctgccggag cccctcaccc tgagatgga                  1669
//