spacer

EBI Dbfetch

ID   GQ250939; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   GQ250939;
XX
DT   19-JUL-2009 (Rel. 101, Created)
DT   15-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B_1810 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RX   DOI; 10.1111/j.1399-0039.2010.01516.x.
RX   PUBMED; 20579313.
RA   Mattar S.B., Uehara C.J., Wowk P.F., Vargas R.G., Bicalho M.G.;
RT   "HLA-B*18:35, a new HLA-B*18 allele identified by sequence-based typing in
RT   a Brazilian volunteer bone marrow donor";
RL   Tissue Antigens 76(4):336-337(2010).
XX
RN   [2]
RP   1-788
RA   Bicalho M.G., Mattar S.B., Uehara C.J., Ribas F.;
RT   "HLA new alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-788
RA   Bicalho M.G., Mattar S.B., Uehara C.J., Ribas F.;
RT   ;
RL   Submitted (03-JUN-2009) to the INSDC.
RL   Genetics, Federal University of Parana, Sala 31, Departamento de Genetica,
RL   Setor de Ciencias Biologicas, Centro Politecnico, Jardim das Americas
RL   CP19071, Curitiba, Parana 81530980, Brazil
XX
DR   MD5; ff48c6760e12222437fc74d79676a7df.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_1810"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_1810"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_1810"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C7E538"
FT                   /db_xref="IMGT/HLA:B*18:35"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C7E538"
FT                   /protein_id="ACT34381.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_1810"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_1810"
FT                   /number=3
XX
SQ   Sequence 788 BP; 111 A; 175 C; 190 G; 70 T; 242 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggtctcac accctccaga ggatgtacgg       540
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg       600
     caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg acaccgcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcagctga gagcctacct       720
     ggagggcgag tgcgtggagt ggctccgcag atacctggag aacgggaagg acaagctgga       780
     gcgcgcgg                                                                788
//


spacer
spacer