Dbfetch

ID   GQ250938; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   GQ250938;
XX
DT   19-JUL-2009 (Rel. 101, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B_4201 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RX   DOI; 10.1111/j.1744-313X.2010.00950.x.
RX   PUBMED; 20718873.
RA   Mattar S.B., Uehara C.J., Ribas F., Vargas R.G., Wowk P.F., Poerner F.,
RA   Bicalho M.G.;
RT   "A new allele, HLA-B*4212, identified in a Brazilian volunteer bone marrow
RT   donors by sequence-based typing";
RL   Int. J. Immunogenet. 37(6):517-518(2010).
XX
RN   [2]
RP   1-788
RA   Bicalho M.G., Mattar S.B., Uehara C.J., Ribas F.;
RT   ;
RL   Submitted (03-JUN-2009) to the INSDC.
RL   Genetics, Federal University of Parana, Sala 31, Departamento de Genetica,
RL   Setor de Ciencias Biologicas, Centro Politecnico, Jardim das Americas
RL   CP19071, Curitiba, Parana 81530980, Brazil
XX
DR   MD5; 993762d4f46471289971c828a1136960.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_4201"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_4201"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_4201"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*42:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C7E537"
FT                   /protein_id="ACT34380.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   GEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_4201"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B_4201"
FT                   /number=3
XX
SQ   Sequence 788 BP; 111 A; 174 C; 193 G; 68 T; 242 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggtctcac accctccaga gcatgtacgg       540
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat aaccagtacg cctacgacgg       600
     caaggattac atcgccctga acgaggacct gcgctcctgg accgcggcgg acaccgcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcaggaca gagcctacct       720
     ggagggcacg tgcggggagt ggctccgcag atacctggag aacgggaagg acacgctgga       780
     gcgcgcgg                                                                788
//