spacer

EBI Dbfetch

ID   GQ202277; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ202277;
XX
DT   15-JUL-2009 (Rel. 101, Created)
DT   15-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Zhao B., Shan X., Cui S., Wang L., Ni L., Wang L., Li W., Liu N., He X.,
RA   Gong Z., Zhang Z.;
RT   "Identified a novel allele HLA-DRB1 by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Zhao B., Shan X., Cui S., Wang L., Ni L., Wang L., Li W., Liu N., He X.,
RA   Gong Z., Zhang Z.;
RT   ;
RL   Submitted (22-MAY-2009) to the INSDC.
RL   HLA lab, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; 4bbbd545c935dd715fa100f59fd1f625.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C7DRS1"
FT                   /db_xref="IMGT/HLA:DRB1*14:91"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C7DRS1"
FT                   /protein_id="ACT21079.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   variation       97
FT                   /gene="HLA-DRB1"
FT                   /replace="t"
FT                   /note="results in serine to phenylalanine substitution;
FT                   compared to allele HLA-DRB1*1405"
XX
SQ   Sequence 270 BP; 56 A; 64 C; 99 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer