spacer

EBI Dbfetch

ID   GQ202275; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ202275;
XX
DT   10-AUG-2009 (Rel. 101, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23330723.
RA   Wang L., Zhang Z., Wang L., Cui S., Shan X.;
RT   "Identification of a novel HLA-A allele, A*24:128 in a Chinese individual";
RL   Tissue Antigens 81(2):120-121(2013).
XX
RN   [2]
RP   1-270
RA   Liu N., Shan X., Li W., Wang L., He X., Ni L., Cui S., Wang L., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   "Identification of a novel allele by SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Liu N., Shan X., Li W., Wang L., He X., Ni L., Cui S., Wang L., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   ;
RL   Submitted (12-MAY-2009) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing, Beijing 100088, China
XX
DR   MD5; bd5c8a10b4132a495cda63da4c4d8149.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA"
FT   mRNA            <1..>270
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C7DRR9"
FT                   /db_xref="IMGT/HLA:A*24:128"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C7DRR9"
FT                   /protein_id="ACU00666.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWMEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEA"
FT   variation       155
FT                   /gene="HLA"
FT                   /replace="a"
XX
SQ   Sequence 270 BP; 54 A; 84 C; 96 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatggagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer