Dbfetch

ID   GQ202274; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   GQ202274;
XX
DT   10-AUG-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Liu N., Shan X., Li W., Wang L., He X., Ni L., Cui S., Wang L., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   "Identification of a novel allele by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Liu N., Shan X., Li W., Wang L., He X., Ni L., Cui S., Wang L., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   ;
RL   Submitted (12-MAY-2009) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing, Beijing 100088, China
XX
DR   MD5; a586ecc9a1e3d2f79205aca9bc7dd8be.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA"
FT   mRNA            <1..>276
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:127"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C7DRR8"
FT                   /protein_id="ACU00665.2"
FT                   /translation="SHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQLT"
FT   variation       271
FT                   /gene="HLA"
FT                   /replace="g"
XX
SQ   Sequence 276 BP; 56 A; 81 C; 98 G; 41 T; 0 other;
     gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggacggg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc tcacgg                                 276
//