spacer

EBI Dbfetch

ID   GQ200571; SV 1; linear; genomic DNA; STD; HUM; 1655 BP.
XX
AC   GQ200571;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   07-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*1203v allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1655
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   "A Novel HLA-C*1203 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1655
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   ;
RL   Submitted (22-MAY-2009) to the INSDC.
RL   All Children's Hospital, 127 Aranda St. NE, St. Petersburg, FL 33704, USA
XX
DR   MD5; f4301f84ae115a8ff65099f492fd865e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1655
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1655
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1203v"
FT   mRNA            join(<1..270,517..792,1380..>1655)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1203v"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1380..>1655)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1203v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C6KF33"
FT                   /db_xref="IMGT/HLA:C*12:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6KF33"
FT                   /protein_id="ACS93143.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSHHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   gap             271..516
FT                   /estimated_length=246
FT   gap             793..1379
FT                   /estimated_length=587
XX
SQ   Sequence 1655 BP; 169 A; 254 C; 287 G; 112 T; 833 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagtggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggactgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag tggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna      1380
     acacccaaag acacacgtga cccaccatcc cgtctctcac catgaggcca ccctgaggtg      1440
     ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga      1500
     ccaaactcag gacaccgagc ttgtggagac caggccagca ggagatggaa ccttccagaa      1560
     gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacgtgcc atgtgcagca      1620
     cgaggggctg ccagagcccc tcaccctgag atggg                                 1655
//


spacer
spacer