spacer

EBI Dbfetch

ID   GQ199711; SV 1; linear; genomic DNA; STD; HUM; 1663 BP.
XX
AC   GQ199711;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   27-APR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Homo sapiens isolate PT08-278 MHC class I antigen (HLA-A) gene,
DE   HLA-A*330301 variant allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1663
RX   DOI; 10.1111/j.1399-0039.2011.01793.x.
RX   PUBMED; 22034849.
RA   Joo S.Y., Song E.Y., Huh J.Y., Kang M.S., Park M.H.;
RT   "HLA-A*33:25, a novel allele identified by sequence-based typing, is a
RT   well-documented allele in Koreans";
RL   Tissue Antigens 79(2):134-135(2012).
XX
RN   [2]
RP   1-1663
RA   Joo S.Y., Shin Y., Song E.Y., Park M.H.;
RT   ;
RL   Submitted (21-MAY-2009) to the INSDC.
RL   Department of Laboratory Medicine, Seoul National University College of
RL   Medicine, 101 Daehangno, Jongno-gu, Seoul 110-744, Korea
XX
DR   MD5; 3b416874362a610c073260804e52169e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1663
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="PT08-278"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: HLA-A_exon 2_forward, fwd_seq:
FT                   atgacagatgcmaaatgcct, rev_name: HLA-A_exon 2_reverse,
FT                   rev_seq: cactcaccggcctcgctctgg"
FT                   /PCR_primers="fwd_name: HLA-A_exon 3_forward, fwd_seq:
FT                   gggctcgggggacyggg, rev_name: HLA-A_exon 3_reverse, rev_seq:
FT                   gacacccccytctccctcct"
FT                   /PCR_primers="fwd_name: HLA-A_exon 4_forward, fwd_seq:
FT                   tcgggcrggtctcagcc, rev_name: HLA-A_exon 4_reverse, rev_seq:
FT                   gaggcgccccgtggc"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1663
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*330301 variant"
FT   mRNA            join(<1..270,512..787,1388..>1663)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*330301 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1388..>1663)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*330301 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C6KF02"
FT                   /db_xref="IMGT/HLA:A*33:25"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6KF02"
FT                   /protein_id="ACS94260.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPTGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*330301 variant"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*330301 variant"
FT                   /number=3
FT   gap             788..1387
FT                   /estimated_length=600
FT   exon            1388..1663
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*330301 variant"
FT                   /number=4
FT   variation       1546
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared to A*330301"
XX
SQ   Sequence 1663 BP; 166 A; 249 C; 283 G; 124 T; 841 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagat gatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc agcaggacgc ctacgacggc       600
     aaggattaca tcgccttgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnacc cccccaagac gcatatgact caccacgctg tctctgacca tgaggccacc      1440
     ctgaggtgct gggccctgag cttctaccct gcggagatca cactgacctg gcagcgggat      1500
     ggggaggacc agacccagga cacggagctc gtggagacca ggcctacagg ggatggaacc      1560
     ttccagaagt gggcgtctgt ggtggtgcct tctggacagg agcagagata cacctgccat      1620
     gtgcagcatg agggtctccc caagcccctc accctgagat ggg                        1663
//


spacer
spacer