Dbfetch

ID   GQ161933; SV 1; linear; genomic DNA; STD; HUM; 2676 BP.
XX
AC   GQ161933;
XX
DT   23-JUN-2009 (Rel. 101, Created)
DT   23-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*440302 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2676
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2676
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (14-MAY-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 9fcac4fbbe8fd92d125550cd06db12c1.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2676
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2676
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440302"
FT   mRNA            join(<1..73,203..472,716..991,1567..1842,1936..2052,
FT                   2494..2526,2633..>2676)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440302"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,716..991,1567..1842,1936..2052,
FT                   2494..2526,2633..2676)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440302"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q2L6G2"
FT                   /db_xref="IMGT/HLA:B*44:03:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L6G2"
FT                   /protein_id="ACS37220.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 2676 BP; 497 A; 794 C; 856 G; 529 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagagag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       300
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagaga acctgcgcac cgcgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccgagg ccgcgggacc cgcccagacc ctcgaccggc       600
     gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt       660
     tggtcggggc ggggcggggc tcgggggacg gggctgaccg cggggccggg gccagggtct       720
     cacatcatcc agaggatgta tggctgcgac gtggggccgg acgggcgcct cctccgcggg       780
     tatgaccagg acgcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc       840
     tggaccgcgg cggacaccgc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg       900
     gcggagcagc tgagagccta cctggagggc ctgtgcgtgg agtcgctccg cagatacctg       960
     gagaacggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca      1020
     tctcctatag gtcgccgggg atggcctccc acgagaagag gaggaaaatg ggatcagcgc      1080
     tagaatgtcg ccctcccttg aatggagaat ggcatgagtt ttcctgagtt tcctctgagg      1140
     gccccctctt ctctctagga caattaaggg atgacgtctc tgaggaaatg gaggggaaga      1200
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1260
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1320
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1380
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgcg tccaggctgg      1440
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1500
     atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1560
     catcagaccc cccaaagaca catgtgaccc accaccccat ctctgaccat gaggtcaccc      1620
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gcgaggacca aactcaggac accgagcttg tggagaccag accagcagga gatagaacct      1740
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      1800
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      1860
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      1920
     cccttccttt cccagagccg tcttcccagt ccaccgtccc catcgtgggc attgttgctg      1980
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga      2040
     ggaagagctc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg tcccactggg      2100
     ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggaagcag catccacaca      2160
     ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc agcacatgtg      2220
     acaatgaagg acggatgtat caccttggtg gttgtggtgt tggggtcctg attccagcat      2280
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tggtccagga      2340
     cccacacttg ctttcctcgt gtttcctgat cctgccttgg gtctgtagtc atacttctgg      2400
     aaattccttt tgggtccaag acgaggaggt tcctctaaga tctcatggcc ctgcttcctc      2460
     ccagtcccct cacagggcat tttcttccca caggtggaaa aggagggagc tactctcagg      2520
     ctgcgtgtaa gtgatggggg cgggagtgtg gaggagctca cccaccccat aattcctcct      2580
     gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc aggcagcgac      2640
     agtgcccagg gctctgatgt gtctctcaca gcttga                                2676
//