spacer

EBI Dbfetch

ID   GQ161931; SV 2; linear; genomic DNA; STD; HUM; 2675 BP.
XX
AC   GQ161931;
XX
DT   23-JUN-2009 (Rel. 101, Created)
DT   24-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4202 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2675
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2675
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (14-MAY-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2675
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (23-SEP-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 2375e1e312bbe00b824f38ac632f5b11.
XX
CC   On Sep 23, 2009 this sequence version replaced gi:239997695.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2675
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2675
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4202"
FT   mRNA            join(<1..73,202..471,718..993,1566..1841,1935..2051,
FT                   2493..2525,2632..>2675)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4202"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,718..993,1566..1841,1935..2051,
FT                   2493..2525,2632..2675)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4202"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C6K6H9"
FT                   /db_xref="IMGT/HLA:B*42:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6K6H9"
FT                   /protein_id="ACS37218.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 2675 BP; 494 A; 801 C; 853 G; 527 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcaccccca ggctcccact ccatgaggta tttccacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatcta caaggcccag gcacagactg       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg gacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca ggacagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggacacg ctggagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag acaattaagg gatgacgtct ctgaggaaat ggaggggaag      1200
     acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1260
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1320
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1380
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc atccgctggt      1440
     gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt ccattctcag gctggtcaca      1500
     tgggtggtcc tagggtgtgc catgagagat gcaaagcgcc tgaattttct gactcttccc      1560
     atcagacccc ccaaagacac acgtgaccca ccaccccatc tctgaccatg aggccaccct      1620
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1680
     cgaggaccaa actcaggaca ctgagcttgt ggagaccaga ccagcaggag atagaacctt      1740
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca catgccatgt      1800
     acagcatgag gggctgccga agcccctcac cctgagatgg ggtaaggagg gggatgaggg      1860
     gtcatatctc ttctcaggga aagcaggagc ccttcagcag ggtcagggcc cctcatcttc      1920
     ccctcctttc ccagagccgt cttcccagtc caccgtcccc atcgtgggca ttgttgctgg      1980
     cctggctgtc ctagcagttg tggtcatcgg agctgtggtc gctgctgtga tgtgtaggag      2040
     gaagagctca ggtagggaag gggtgagggg tggggtctgg gttttcttgt cccactgggg      2100
     gtttcaagcc ccaggtagaa gtgttccctg cctcattact gggatgcagc atccacacag      2160
     gggctaacgc agcctgggac cctgtgtgcc agcacttact cttttgtgca gcacatgtga      2220
     caatgaagga cggatgtatc accttggtgg ttgtggtgtt ggggtcctga ttccagcatt      2280
     catgagtcag gggaaggtcc ctgctaagga cagaccttag gagggcagtt ggtccaggac      2340
     ccacacttgc tttcctcgtg tttcctgatc ctgccttggg tctgtagtca tacttctgga      2400
     aattcctttt gggtccaaga cgaggaggtt cctctaagat ctcatggccc tgcttcctcc      2460
     cagtcccctc acagggcatt ttcttcccac aggtggaaaa ggagggagct actctcaggc      2520
     tgcgtgtaag tgatgggggt gggagtgtgg aggagctcac ccaccccata attcctcctg      2580
     tcccacgtct cctgcgggct ctgaccaggt cctgtttttg ttctactcca ggcagcgaca      2640
     gtgcccaggg ctctgatgtg tctctcacag cttga                                 2675
//


spacer
spacer