spacer

EBI Dbfetch

ID   GQ148551; SV 1; linear; genomic DNA; STD; HUM; 248 BP.
XX
AC   GQ148551;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*01 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-248
RA   Thompson E.M., Kashi Z.M., Martin R.K.;
RT   "Homo sapiens major histocompatibility complex class II HLA-DRB1*01 novel
RT   allele";
RL   Unpublished.
XX
RN   [2]
RP   1-248
RA   Thompson E.M., Kashi Z.M., Martin R.K.;
RT   ;
RL   Submitted (11-MAY-2009) to the INSDC.
RL   Laboratory, Kashi Clinical Laboratories, 8075 SW Nimbus Ave., Beaverton, OR
RL   97008, USA
XX
DR   MD5; 04ea206d5c0a79bbb9555b80500ea8aa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..248
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>248
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01"
FT   mRNA            <1..>248
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>248
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C5MRD8"
FT                   /db_xref="IMGT/HLA:DRB1*01:22"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C5MRD8"
FT                   /protein_id="ACS28226.1"
FT                   /translation="QLNFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELG
FT                   RPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 248 BP; 55 A; 57 C; 91 G; 45 T; 0 other;
     ggcagcttaa ctttgaatgt catttcttca atgggacgga gcgggtgcgg ttgctggaaa        60
     gatgcatcta taaccaagag gagtccgtgc gcttcgacag cgacgtgggg gagtaccggg       120
     cggtgacgga gctggggcgg cctgatgccg agtactggaa cagccagaag gacctcctgg       180
     agcagaggcg ggccgcggtg gacacctact gcagacacaa ctacggggtt ggtgagagct       240
     tcacagtg                                                                248
//


spacer
spacer