spacer

EBI Dbfetch

ID   GQ118997; SV 1; linear; genomic DNA; STD; HUM; 2677 BP.
XX
AC   GQ118997;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*270401 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2677
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2677
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (05-MAY-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 68eb4ac6dc6704c2204d399dcc132446.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2677
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2677
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270401"
FT   mRNA            join(<1..73,203..472,717..992,1568..1843,1937..2053,
FT                   2495..2527,2634..>2677)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270401"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,717..992,1568..1843,1937..2053,
FT                   2495..2527,2634..2677)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270401"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5MK52"
FT                   /db_xref="IMGT/HLA:B*27:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5MK52"
FT                   /protein_id="ACR81570.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDRESLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPGEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 2677 BP; 492 A; 795 C; 863 G; 527 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       300
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct gcaaggccaa ggcacagact       420
     gaccgagaga gcctgcggac cctgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccgagg ccgcgggacc cgcccagacc ctcgaccggc       600
     gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt       660
     tggtcggggc ggggcggggc tcggggggac ggggctgacc gcggggccgg ggccagggtc       720
     tcacaccctc cagaatatgt atggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gtaccaccag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc       840
     ctggaccgcc gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat ggaggggaag      1200
     acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1260
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1320
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1380
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1440
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1500
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1560
     ccatcagacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg cttctaccct ggggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      1860
     gggtcatatc tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct      1920
     tcccttcctt tcccagagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct      1980
     ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg      2040
     aggaagagct caggtaggga aggggtgagg ggtggggtct gagttttctt gtcccactgg      2100
     gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatccacac      2160
     aggggctaac gcagcctggg accctgtgtg ccagcactta ctcttttgtg cagcacatgt      2220
     gacaatgaag gacggatgta tcaccttggt ggttgtggtg ttggggtcct gattccagca      2280
     ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg      2340
     acccacactt gctttcctcg tgtttcctga tcctgccttg ggtctgtagt catacttctg      2400
     gaaattcctt ttgggtccaa gacgaggagg ttcctctaag atctcatggc cctgcttcct      2460
     cccagtcccc tcacagggca ttttcttccc acaggtggaa aaggagggag ctactctcag      2520
     gctgcgtgta agtgatgggg gtgggagtgt ggaggagctc acccaccccc taattcctcc      2580
     tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc caggcagcga      2640
     cagtgcccag ggctctgatg tgtctctcac agcttga                               2677
//


spacer
spacer