Dbfetch

ID   GQ118994; SV 2; linear; genomic DNA; STD; HUM; 2686 BP.
XX
AC   GQ118994;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   17-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1802 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2686
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2686
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (05-MAY-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2686
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (15-SEP-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; ba01be9495db45e331f731023378e599.
XX
CC   On Sep 15, 2009 this sequence version replaced gi:239509157.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2686
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2686
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT   mRNA            join(<1..73,202..471,718..993,1566..1841,1946..2062,
FT                   2504..2536,2643..>2686)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,718..993,1566..1841,1946..2062,
FT                   2504..2536,2643..2686)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5MK49"
FT                   /db_xref="IMGT/HLA:B*18:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C5MK49"
FT                   /protein_id="ACR81567.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQNMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 2686 BP; 499 A; 805 C; 849 G; 533 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct ccttgcccca ggctcccact ccatgaggta tttccacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacggc acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga ggacggagcc ccgggcgccg tggatagagc       360
     aagaggggcc ggagtattgg gaccggaaca cacagatctc caagaccaac acacagactt       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cccccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagaatatg tatggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcatgacca gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca gctgagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagacacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcccgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     atgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc tctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag attatcccag gtgcctgcgt ccaggctggt      1440
     gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt ccattctcag gctggtcaca      1500
     tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc tgaattttct gactcttccc      1560
     atcagacccc ccaaagacac atgtgaccca ccaccccatc tctgaccatg aggccaccct      1620
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1680
     cgaggaccaa actcaggaca ccgagcttgt ggagaccaga ccagcaggag atagaacctt      1740
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca catgccatgt      1800
     acagcatgag gggctgccga agcccctcac cctgagatgg ggtaaggagg gggatgaggg      1860
     gtcatatctc ttctcaggga aagcaggagc ccttctggag cccttcagca gggtcagggc      1920
     ccctcatctt cccctccttt cccagagcca tcttcccagt ccaccatccc catcgtgggc      1980
     attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctactgtg      2040
     atgtgtagga ggaagagctc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg      2100
     tcccactggg ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggaagcag      2160
     catccacaca ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc      2220
     agcacatgtg acaatgaagg acggatgtat caccttgatg gttgtggtgt tggggtcctg      2280
     attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt      2340
     tggtccagga cccacacttg ctttcctcgt gtttcctgat cctgccttgg gtctgtagtc      2400
     atacttctgg aaattccttt tggttccaag acgaggaggt tcctctaaga tctcatggcc      2460
     ctgcttcctc ccagtcccct cacaggacat tttcttccca caggtggaaa aggagggagc      2520
     tactctcagg ctgcgtgtaa gtggtggggg tgggagtgtg gaggagctca cccaccccat      2580
     aattcctcct gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc      2640
     agccagcgac agtgcccagg gctctgatgt gtctctcaca gcttga                     2686
//