spacer

EBI Dbfetch

ID   FR852581; SV 1; linear; genomic DNA; STD; PRO; 732 BP.
XX
AC   FR852581;
XX
DT   16-MAY-2011 (Rel. 108, Created)
DT   26-MAR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Ruegeria pomeroyi DSS-3 partial SPO_PG038 gene for aminotransferase, strain
DE   DSM 15171
XX
KW   .
XX
OS   Ruegeria pomeroyi DSS-3
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Ruegeria.
XX
RN   [1]
RP   1-732
RA   Christie-Oleza J.;
RT   ;
RL   Submitted (11-APR-2011) to the INSDC.
RL   LBSP, CEA Marcoule, BP 17171, Bagnols sur Ceze cedex, F-30207, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-13-73.
RX   PUBMED; 22336032.
RA   Christie-Oleza J.A., Miotello G., Armengaud J.;
RT   "High-throughput proteogenomics of Ruegeria pomeroyi: seeding a better
RT   genomic annotation for the whole marine Roseobacter clade";
RL   BMC Genomics 13:73-73(2012).
XX
DR   MD5; 32d9a863a52aac7758eeabc45f7dee7b.
DR   EuropePMC; PMC3305630; 22336032.
DR   StrainInfo; 340589; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..732
FT                   /organism="Ruegeria pomeroyi DSS-3"
FT                   /strain="DSS-3 = DSM 15171"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:246200"
FT                   /culture_collection="DSM:15171"
FT   CDS             <1..718
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="SPO_PG038"
FT                   /product="aminotransferase"
FT                   /db_xref="GOA:F6IBE2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F6IBE2"
FT                   /protein_id="CCA65728.1"
FT                   /translation="TVTDPAQSTLQLANSETGIIQDLPQGLAVSDATQAFGKIPVAFNW
FT                   LGAEMALISAHKLGGPKGIGALVIRRGTDLAAQIKGGGQEMGRRSGTENVIGIAGFGAA
FT                   AEAAARDLADGVWERVEKLRNILEKALEAGAKSTIFVGKGRPRLPNTLCLATPGWKGET
FT                   QVMQMDLAGFAISAGSACSSGKVRASAVLQAMGFDEATAASAIRVSLGPETSETDVLRF
FT                   AEAWLQKEKKHRARAA"
XX
SQ   Sequence 732 BP; 149 A; 212 C; 253 G; 118 T; 0 other;
     tacggtgacc gaccccgcgc aatcgacctt gcaattggcc aattccgaga ccggtatcat        60
     ccaggacctg ccacaggggc tggcggtgag cgatgcaacc caggcctttg gcaagatacc       120
     ggtcgccttc aattggctcg gggccgagat ggcgctgatt tcggcgcata agctgggtgg       180
     ccccaagggc attggcgcgc tggtgatacg acgcggcacc gatctggcgg cgcagatcaa       240
     gggcggcggg caggaaatgg gccgccgttc gggcaccgag aacgtgatcg gcatcgccgg       300
     tttcggcgct gcagccgaag ccgccgcgcg cgatctggcc gatggcgtct gggagcgggt       360
     ggagaaactt agaaatattc tagaaaaggc tcttgaggcc ggtgcaaaat ctactatttt       420
     tgtcgggaaa ggtcgacccc gcctgcccaa caccctttgc ctggccacac cgggttggaa       480
     gggcgagacg caggtgatgc agatggacct ggccggtttt gccatcagcg ccggcagcgc       540
     ctgctccagc ggcaaggtcc gtgccagcgc ggtgctgcaa gcaatggggt ttgacgaggc       600
     cacggcggca agcgcgatcc gcgtctcgct ggggcccgaa acgagcgaaa cggatgtgct       660
     gcgctttgcc gaggcgtggt tgcagaaaga aaagaaacac cgcgcgcgcg ccgcgtgaca       720
     cagaacaaac ag                                                           732
//


spacer
spacer