spacer

EBI Dbfetch

ID   FR852579; SV 1; linear; genomic DNA; STD; PRO; 424 BP.
XX
AC   FR852579;
XX
DT   16-MAY-2011 (Rel. 108, Created)
DT   26-MAR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Ruegeria pomeroyi DSS-3 SPO_PG036 gene for ABC transporter, strain DSM
DE   15171
XX
KW   .
XX
OS   Ruegeria pomeroyi DSS-3
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Ruegeria.
XX
RN   [1]
RP   1-424
RA   Christie-Oleza J.;
RT   ;
RL   Submitted (11-APR-2011) to the INSDC.
RL   LBSP, CEA Marcoule, BP 17171, Bagnols sur Ceze cedex, F-30207, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-13-73.
RX   PUBMED; 22336032.
RA   Christie-Oleza J.A., Miotello G., Armengaud J.;
RT   "High-throughput proteogenomics of Ruegeria pomeroyi: seeding a better
RT   genomic annotation for the whole marine Roseobacter clade";
RL   BMC Genomics 13:73-73(2012).
XX
DR   MD5; d4bc7072b8cafd1a994434016cae913e.
DR   EuropePMC; PMC3305630; 22336032.
DR   StrainInfo; 340589; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..424
FT                   /organism="Ruegeria pomeroyi DSS-3"
FT                   /strain="DSS-3 = DSM 15171"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:246200"
FT                   /culture_collection="DSM:15171"
FT   CDS             1..>424
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="SPO_PG036"
FT                   /product="ABC transporter"
FT                   /db_xref="GOA:F6IBE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F6IBE0"
FT                   /protein_id="CCA65726.1"
FT                   /translation="MTPLLSVENLSIGFGRGDAVVRDVSFEVMPGQTLALVGESGSGKT
FT                   VTCRAVLRILPKAAQIRTGRITLNGQDGPLTLNQLGERQLRAIRGNRISMIFQEPMRSL
FT                   SPLHRIGNQVSEVLWLHRGASEREARKTVLEQFERVG"
XX
SQ   Sequence 424 BP; 73 A; 133 C; 146 G; 72 T; 0 other;
     atgacccctt tgttgtctgt cgaaaacctc agcatcggct ttggccgggg cgacgccgtg        60
     gtgcgcgacg tcagtttcga ggtgatgccg gggcagacat tggcgctggt gggcgaatcc       120
     ggctcgggca agaccgtcac ctgccgggcc gtgctgcgca tcctgcccaa ggcggcgcaa       180
     atccgcaccg gccgcatcac cctgaacggc caggacgggc cgctgaccct gaaccagctt       240
     ggcgaacggc agttgcgcgc gatccggggc aaccgcatct cgatgatctt tcaggagccg       300
     atgcgttcgc tttcaccgct gcaccggatc ggcaatcagg tcagcgaggt gctgtggctg       360
     catcgcggcg ccagcgagcg cgaggcccgc aagaccgtgc tggaacagtt cgaaagggtg       420
     ggat                                                                    424
//


spacer
spacer