spacer

EBI Dbfetch

ID   FR846097; SV 1; linear; genomic DNA; STD; INV; 324 BP.
XX
AC   FR846097;
XX
DT   09-NOV-2012 (Rel. 114, Created)
DT   09-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Metacrangonyx longipes partial h3a gene for histone H3a, isolate ARM11
XX
KW   .
XX
OS   Metacrangonyx longipes
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Malacostraca;
OC   Eumalacostraca; Peracarida; Amphipoda; Gammaridea; Hadzioidea;
OC   Metacrangonyctidae; Metacrangonyx.
XX
RN   [1]
RP   1-324
RA   Bauza-Ribot M.M.;
RT   ;
RL   Submitted (04-MAR-2011) to the INSDC.
RL   Bauza-Ribot M.M., Biology, Universitat de les Illes Balears,
RL   Ctra.Valldemossa km 7.5, 07122, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-11-221.
RX   PUBMED; 21791038.
RA   Bauza-Ribot M., Jaume D., Fornos J.J., Juan C., Pons J.;
RT   "Islands beneath islands: phylogeography of a groundwater amphipod
RT   crustacean in the Balearic archipelago";
RL   BMC Evol. Biol. 11:221-221(2011).
XX
DR   MD5; c1ee3beed29135092b325e4dce8d3418.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..324
FT                   /organism="Metacrangonyx longipes"
FT                   /isolate="ARM11"
FT                   /mol_type="genomic DNA"
FT                   /country="Spain:Balearic Islands"
FT                   /db_xref="taxon:510302"
FT   CDS             <1..>324
FT                   /codon_start=3
FT                   /gene="h3a"
FT                   /product="histone H3a"
FT                   /db_xref="GOA:K7ZTS3"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:K7ZTS3"
FT                   /protein_id="CCA61052.1"
FT                   /translation="KSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR
FT                   YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI
FT                   HAK"
XX
SQ   Sequence 324 BP; 69 A; 102 C; 83 G; 70 T; 0 other;
     gcaagtctac cggaggaaag gctccacgca agcagcttgc tacaaaggct gctcgcaagt        60
     ccgcccctgc tactggtggt gtcaagaagc cacataggta caggcccggt accgtcgctc       120
     tccgtgagat tcgtcgctac cagaagagca ctgagctgct cattcgcaag cttccattcc       180
     agcgactcgt ccgtgagatc gcgcaggact tcaagactga cttgcgcttc cagtcgtccg       240
     ctgtgatggc tcttcaggaa gcctctgagg cttacctcgt cggtctcttc gaagatacca       300
     acctgtgcgc tattcacgcc aaac                                              324
//


spacer
spacer