spacer

EBI Dbfetch

ID   FR846096; SV 1; linear; genomic DNA; STD; INV; 356 BP.
XX
AC   FR846096;
XX
DT   09-NOV-2012 (Rel. 114, Created)
DT   09-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Metacrangonyx sp. MB2010 mitochondrial partial cob gene for cytochrome b
DE   oxydase, isolate TAMOU
XX
KW   .
XX
OS   Metacrangonyx sp. MB2010
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Malacostraca;
OC   Eumalacostraca; Peracarida; Amphipoda; Gammaridea; Hadzioidea;
OC   Metacrangonyctidae; Metacrangonyx.
OG   Mitochondrion
XX
RN   [1]
RP   1-356
RA   Bauza-Ribot M.M.;
RT   ;
RL   Submitted (04-MAR-2011) to the INSDC.
RL   Bauza-Ribot M.M., Biology, Universitat de les Illes Balears,
RL   Ctra.Valldemossa km 7.5, 07122, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-11-221.
RX   PUBMED; 21791038.
RA   Bauza-Ribot M., Jaume D., Fornos J.J., Juan C., Pons J.;
RT   "Islands beneath islands: phylogeography of a groundwater amphipod
RT   crustacean in the Balearic archipelago";
RL   BMC Evol. Biol. 11:221-221(2011).
XX
DR   MD5; f3550d26a1b6edebc8a700c80d6717de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..356
FT                   /organism="Metacrangonyx sp. MB2010"
FT                   /organelle="mitochondrion"
FT                   /isolate="TAMOU"
FT                   /mol_type="genomic DNA"
FT                   /country="Morocco:Tamri"
FT                   /db_xref="taxon:931574"
FT   CDS             <1..>356
FT                   /transl_table=5
FT                   /gene="cob"
FT                   /product="cytochrome b oxydase"
FT                   /db_xref="GOA:K7ZU59"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:K7ZU59"
FT                   /protein_id="CCA61051.1"
FT                   /translation="LLSEVPYIGPNLIELVWGSPSVNSPTIMRFFSFHFMLPFLIAAFT
FT                   IIHIALLHETGSKNPLGMLSTNNKYMFNPIFIFKDLLGFIISLLLLLFISLLYPLTLGD
FT                   DENFFNFNPYVTPI"
XX
SQ   Sequence 356 BP; 114 A; 71 C; 30 G; 141 T; 0 other;
     ttattatcag aagtaccata tattggtcca aatttaattg aattagtctg aggctcaccc        60
     tccgtaaact ccccaacaat tatacgtttt ttttcattcc attttatact acctttttta       120
     atcgcagcat ttacaattat tcatatcgca ctcctacatg aaacaggatc aaaaaatcca       180
     cttggaatgc tatctactaa taataaatat atattcaacc ctatcttcat ttttaaagat       240
     ttactaggat ttattatctc attactttta cttctattta ttagtttatt atacccatta       300
     accttaggtg atgatgaaaa cttttttaat tttaaccctt atgtaacacc tatcca           356
//


spacer
spacer