spacer

EBI Dbfetch

ID   FR846061; SV 1; linear; genomic DNA; STD; INV; 357 BP.
XX
AC   FR846061;
XX
DT   09-NOV-2012 (Rel. 114, Created)
DT   09-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Metacrangonyx longipes mitochondrial partial cob gene for cytochrome b
DE   oxydase, isolate ARM11
XX
KW   .
XX
OS   Metacrangonyx longipes
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Malacostraca;
OC   Eumalacostraca; Peracarida; Amphipoda; Gammaridea; Hadzioidea;
OC   Metacrangonyctidae; Metacrangonyx.
OG   Mitochondrion
XX
RN   [1]
RP   1-357
RA   Bauza-Ribot M.M.;
RT   ;
RL   Submitted (04-MAR-2011) to the INSDC.
RL   Bauza-Ribot M.M., Biology, Universitat de les Illes Balears,
RL   Ctra.Valldemossa km 7.5, 07122, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-11-221.
RX   PUBMED; 21791038.
RA   Bauza-Ribot M., Jaume D., Fornos J.J., Juan C., Pons J.;
RT   "Islands beneath islands: phylogeography of a groundwater amphipod
RT   crustacean in the Balearic archipelago";
RL   BMC Evol. Biol. 11:221-221(2011).
XX
DR   MD5; 7f5b7c5e356b8f731e02d5f2d40eaf65.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..357
FT                   /organism="Metacrangonyx longipes"
FT                   /organelle="mitochondrion"
FT                   /isolate="ARM11"
FT                   /mol_type="genomic DNA"
FT                   /country="Spain:Balearic Islands"
FT                   /db_xref="taxon:510302"
FT   CDS             <1..>357
FT                   /transl_table=5
FT                   /gene="cob"
FT                   /product="cytochrome b oxydase"
FT                   /db_xref="GOA:K7ZTM8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:K7ZTM8"
FT                   /protein_id="CCA61016.1"
FT                   /translation="LLSEVPYIGPNLIELVWGSPSVSTPTIMRFFSFHFMLPFVILTLT
FT                   IVHIALLHETGSKNPLGTKSSSNKYMFNPIFIFKDMLGFILALTLFLFITLLMPLVLGD
FT                   DENFFNLNPYVTPIH"
XX
SQ   Sequence 357 BP; 102 A; 67 C; 35 G; 153 T; 0 other;
     ttattatctg aagtacccta tatcggacct aatctaattg aactagtttg aggctcacct        60
     tctgttagta ctcctactat tatacggttt ttttctttcc attttatatt accttttgta       120
     attcttacct taaccattgt tcatatcgct ctattacacg aaacaggctc taaaaacccc       180
     ttgggtacta aatcatcttc taataaatat atatttaacc ctatctttat ttttaaagat       240
     atattaggct ttatcctagc cttaacctta tttttattta ttactttatt gatacctttg       300
     gtattaggag atgacgaaaa tttttttaat ttaaatcctt atgtaactcc aattcat          357
//


spacer
spacer