spacer

EBI Dbfetch

ID   FR839026; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FR839026;
XX
DT   16-MAR-2011 (Rel. 108, Created)
DT   16-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*13, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (07-MAR-2011) to the INSDC.
RL   Anholts J.D.H., Leiden University Medical Center, Immunohematology and
RL   Bloodtransfusion, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "Twenty new sequences found during routine HLA typing";
RL   Unpublished.
XX
DR   MD5; 3162a5f782bda1a9bd6704e73338dc11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..264,365..>646)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*13"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:F2QL91"
FT                   /db_xref="IMGT/HLA:DPB1*133:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2QL91"
FT                   /protein_id="CCA30657.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEERAVPDRICRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*13"
FT                   /number=2
FT   gap             265..364
FT                   /estimated_length=unknown
FT   exon            365..646
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*13"
FT                   /number=3
XX
SQ   Sequence 646 BP; 128 A; 147 C; 175 G; 96 T; 100 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt acgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnntccagc ctagggtgaa tgtttccccc tccaagaagg ggcccttgca gcaccacaac       420
     ctgcttgtct gccacgtgac ggatttctac ccaggcagca ttcaagtccg atggttcctg       480
     aatggacagg aggaaacagc tggggtcgtg tccaccaacc tgatccgtaa tggagactgg       540
     accttccaga tcctggtgat gctggaaatg accccccagc agggagatgt ctacacctgc       600
     caagtggagc acaccagcct ggatagtcct gtcaccgtgg agtgga                      646
//


spacer
spacer