spacer

EBI Dbfetch

ID   FR839024; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FR839024;
XX
DT   16-MAR-2011 (Rel. 108, Created)
DT   16-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*15, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (07-MAR-2011) to the INSDC.
RL   Anholts J.D.H., Leiden University Medical Center, Immunohematology and
RL   Bloodtransfusion, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "Twenty new sequences found during routine HLA typing";
RL   Unpublished.
XX
DR   MD5; 2594dd3d4c19f8dcfe1977af04c38af6.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:F2QL89"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2QL89"
FT                   /protein_id="CCA30655.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /number=3
XX
SQ   Sequence 652 BP; 124 A; 142 C; 180 G; 106 T; 100 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccaacctaa ggtgactgta tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttcctgaacg gccaggaaga gaaggctggg atggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcgaagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgacg agccctctca cagtggaatg ga               652
//


spacer
spacer