spacer

EBI Dbfetch

ID   FR824045; SV 1; linear; genomic DNA; STD; HUM; 2042 BP.
XX
AC   FR824045;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   02-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele
DE   HLA-B*07new, exons 1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2042
RA   Keller E.;
RT   ;
RL   Submitted (22-FEB-2011) to the INSDC.
RL   Keller E., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Keller E., Witter K., Kleinschmidt-Molter E.;
RT   "New HLA-B*07 allele";
RL   Unpublished.
XX
DR   MD5; 7720d03fc90bd1846952e6f8a738c5a4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2042
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="205220"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,202..471,717..992,1629..>1904)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:F0VYJ3"
FT                   /db_xref="IMGT/HLA:B*07:130"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F0VYJ3"
FT                   /protein_id="CBZ47172.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLIWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=1
FT   intron          74..201
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=1
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=2
FT   intron          472..716
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=2
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=3
FT   intron          993..1628
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=3
FT   gap             1268..1367
FT                   /estimated_length=unknown
FT   exon            1629..1904
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=4
FT   intron          1905..>2042
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=4
XX
SQ   Sequence 2042 BP; 369 A; 605 C; 633 G; 335 T; 100 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcaccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatcta caaggcccag gcacagactg       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggac tgggctgacc gcggggccgg ggccagggtc       720
     tcacaccctc cagagcatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcatgaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag cggagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacaagc tggagcgcgc tggtaccagg ggcagtgggg agccttccca      1020
     tctcctatag gtcgccgggg atggcctccc acgagaagag gaggaaaatg ggatcagcgc      1080
     tagaatgtcg ccctccgttg aatggagaat ggcatgagtt ttcctgagtt tcctctgagg      1140
     gccccctctt ctctctagac aattaaggaa tgacgtctct gaggaaatgg aggggaagac      1200
     agtccctaga atactgatca ggggtcccct ttgacccctg cagcagcctt gggaaccgtg      1260
     acttttcnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnttg gggctctgat      1380
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1440
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1500
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1560
     acatgggtgg tcctagggtg tcccatgaaa gatgcaaagc gcctgaattt tctgactctt      1620
     cccatcagac cccccaaaga cacacgtgac ccaccacccc atctctgacc atgaggccac      1680
     cctgaggtgc tgggccctgg gtttctaccc tgcggagatc acactgatct ggcagcggga      1740
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      1800
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      1860
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1920
     ggggtcatat ctcttctcag ggaaagcagg agcccttcag cagggtcagg gcccctcatc      1980
     ttcccctcct ttcccagagc cgtcttccca gtccaccgtc cccatcgtgg gcattgttgc      2040
     tg                                                                     2042
//


spacer
spacer