spacer

EBI Dbfetch

ID   FR822200; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR822200;
XX
DT   16-FEB-2011 (Rel. 107, Created)
DT   16-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*15XX, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wallis-Jones S.;
RT   ;
RL   Submitted (10-FEB-2011) to the INSDC.
RL   Wallis-Jones S., Routine Sequencing, Anthony Nolan Trust, NW3 2QG, London,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Wallis-Jones S.;
RT   "Homo sapiens partial HLA-DRB1 gene for MHC class II antigen
RT   HLA-DRB1*15xx";
RL   Unpublished.
XX
DR   MD5; 39f0009f7942621572102b9f4523a945.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1*"
FT                   /allele="HLA-DRB1*15XX"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:F0V6B9"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F0V6B9"
FT                   /protein_id="CBZ41221.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15XX"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 65 C; 101 G; 49 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttttt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer