spacer

EBI Dbfetch

ID   FR821776; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR821776;
XX
DT   15-FEB-2011 (Rel. 107, Created)
DT   15-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*13:17var, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Mrazek F.;
RT   ;
RL   Submitted (10-FEB-2011) to the INSDC.
RL   Mrazek F., Dept of Immunology, HLA laboratory, Palacky University Hospital,
RL   I.P.Pavlova str. 6, CZ-775 20, CZECH REPUBLIC.
XX
RN   [2]
RA   Mrazek F., Onderkova J., Zachova S., Ambruzova Z., Petrek M.;
RT   "New HLA-DRB1*13:17var alelle identified by sequncing based typing";
RL   Unpublished.
XX
DR   MD5; b7a24fa4175eee3d2d376fb63b5b122b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:17var"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:17var"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E9BVU5"
FT                   /db_xref="IMGT/HLA:DRB1*13:116"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E9BVU5"
FT                   /protein_id="CBZ41175.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 62 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer