Dbfetch

ID   FR773882; SV 1; linear; mRNA; STD; HUM; 270 BP.
XX
AC   FR773882;
XX
DT   20-JAN-2011 (Rel. 107, Created)
DT   20-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*11new, exon 2, clone UK Essen DNA117975
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Horn P.;
RT   ;
RL   Submitted (11-JAN-2011) to the INSDC.
RL   Horn P., Institute for Transfusion Medicine, University Hospital Essen,
RL   Virchowstr. 179, 45147 Essen, GERMANY.
XX
RN   [2]
RA   Horn P.A.;
RT   "A novel HLA-DRB1";
RL   Unpublished.
XX
DR   MD5; 837d9df9e935293c8dec054472ae62cd.
DR   H-InvDB; HIT000647310_02.2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="UK Essen DNA117975"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E8ZWG7"
FT                   /db_xref="H-InvDB:HIT000647310_01.2"
FT                   /db_xref="IMGT/HLA:DRB1*11:107"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E8ZWG7"
FT                   /protein_id="CBY89652.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDEEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 61 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//