spacer

EBI Dbfetch

ID   FR773854; SV 1; linear; genomic DNA; STD; HUM; 1865 BP.
XX
AC   FR773854;
XX
DT   14-JAN-2011 (Rel. 107, Created)
DT   14-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*02_New, exons
DE   1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1865
RA   Tourne S.;
RT   ;
RL   Submitted (11-JAN-2011) to the INSDC.
RL   Tourne S., EFS Alsace, Laboratoire d histocompatibilite, 10 rue Spielmann,
RL   67065 Strasbourg Cedex, FRANCE.
XX
RN   [2]
RA   Froelich N., Weschler B., Bert S., Schell A., Leisenbach R., Tourne S.,
RA   Hanau D.;
RT   "A new HLA-A*02 allele has been isolated. The allele is similar to the
RT   alleles HLA-A*02:01:01:01 and A*02:01:01:02L except that it has deletion of
RT   the nucleotide G in exon 4 at position 814 which induces a stop codon in
RT   exon 4 at positions 887-888-889. Therefore, the encoded proteins stopped at
RT   the aa 295";
RL   Unpublished.
XX
DR   MD5; 3e950db19b82eaf51b2892e17130d6be.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1865
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..73,204..473,715..990,1591..1865)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT   CDS             join(1..73,204..473,715..990,1591..1859)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E7BDE1"
FT                   /db_xref="IMGT/HLA:A*02:305N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E7BDE1"
FT                   /protein_id="CBY89318.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVWCLLDRSRDT
FT                   PAMCSMRVCPSPSP"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=3
FT   intron          991..1590
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=3
FT   exon            1591..1865
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02_New"
FT                   /number=4
XX
SQ   Sequence 1865 BP; 356 A; 571 C; 607 G; 331 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaac       120
     gggcccgcct ggcgggggcg caggacccgg gaagccgcgc cgggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctctca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggt ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac       420
     tcaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccaggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgaccgc ggggtccggg ccaggttctc       720
     acaccgtcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       900
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtcct tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1620
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtgtggtgc cttctggaca      1800
     ggagcagaga tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag      1860
     atggg                                                                  1865
//


spacer
spacer