spacer

EBI Dbfetch

ID   FR751074; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   FR751074;
XX
DT   22-FEB-2011 (Rel. 107, Created)
DT   27-JUN-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Mus cypriacus mitochondrial partial cytb gene for cytochrome b
XX
KW   .
XX
OS   Mus cypriacus (Cypriot mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Cazaux B.;
RT   ;
RL   Submitted (22-DEC-2010) to the INSDC.
RL   Cazaux B., CNRS, ISEM, Place Bataillon, 34090, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-11-124.
RX   PUBMED; 21569527.
RA   Cazaux B., Catalan J., Veyrunes F., Douzery E.J., Britton-Davidian J.;
RT   "Are ribosomal DNA clusters rearrangement hotspots?: a case study in the
RT   genus Mus (Rodentia, Muridae)";
RL   BMC Evol. Biol. 11:124-124(2011).
XX
DR   MD5; 53c4143aecd1a50cc4dd9545a558d5b5.
DR   EuropePMC; PMC3112088; 21569527.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Mus cypriacus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Cyprus:Pachna"
FT                   /sex="male"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:468371"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:F0V4R0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:F0V4R0"
FT                   /protein_id="CBY85122.1"
FT                   /translation="MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQI
FT                   ITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYY
FT                   GSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGILIMLLLLMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLY"
XX
SQ   Sequence 1140 BP; 363 A; 307 C; 145 G; 325 T; 0 other;
     atgacaaaca tacgaaaaac acatccatta tttaaaatta ttaaccactc attcattgac        60
     ttacccgccc catccaacat ttcatcatga tggaactttg gatctcttct aggagtatgc       120
     ctaatagtcc aaatcatcac aggtctattc ttagccatac actatacatc agacacatta       180
     acagccttct catcagtaac acacatctgt cgagacgtga attacgggtg actaatccga       240
     tacatacacg caaatggagc ctcaatattt tttatttgct tattccttca tgtaggacga       300
     ggattatact atggatccta tacattcata gaaacctgaa acatcggagt gcttctactg       360
     ttcgcagtca tagccacagc attcataggc tacgtccttc catgaggaca aatatcattc       420
     tgaggggcta cagttattac aaacctccta tcagccattc catacatcgg gacaaccctg       480
     gtcgaatgaa tttgaggggg cttctcagta gacaaagcca ccttgactcg attcttcgcc       540
     tttcacttca tcttaccatt tatcatcgcg gccctagcaa tcgttcacct tcttttcctc       600
     cacgaaacag gatcaaacaa cccaacagga ttaaactcag acgcagataa aattccattt       660
     cacccctact acacaattaa agatatccta ggtatcctaa ttatattatt acttctcata       720
     actctagtat tatttttccc agatatacta ggagacccgg acaactacat accagccaac       780
     ccattaaaca ccccaccaca tattaagccc gaatgatatt tcctatttgc atacgctatt       840
     ctacgctcaa tccccaacaa actaggagga gtcctagcct taatcctatc tatcctaatt       900
     ttagccctaa tacctttcct acacacttca aagcaacgaa gcctaatatt ccgcccaatc       960
     acacaaactt tatattgaat cctagtagct aacctactga tcctaacctg aatcggaggc      1020
     caaccagtag aacacccatt tattatcatt ggccaactag cctccatctc atacttctca      1080
     atcatcttaa ttctcatacc aatctcagga attattgaag acaaaatact aaaattatat      1140
//


spacer
spacer