spacer

EBI Dbfetch

ID   FR745874; SV 1; circular; genomic DNA; STD; PRO; 72460 BP.
XX
AC   FR745874;
XX
PR   Project:PRJEA60483;
XX
DT   14-JAN-2011 (Rel. 107, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Yersinia enterocolitica subsp. palearctica Y11 plasmid pYVO3 complete
DE   sequence
XX
KW   complete sequence.
XX
OS   Yersinia enterocolitica subsp. palearctica Y11
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
OG   Plasmid pYV03
XX
RN   [1]
RP   1-72460
RA   Batzilla J.;
RT   ;
RL   Submitted (07-DEC-2010) to the INSDC.
RL   Batzilla J., Max von Pettenkofer-Institute, LMU, Pettenkoferstrasse 9a,
RL   Munich, D-80336, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.01484-10.
RX   PUBMED; 21296963.
RA   Batzilla J., Hoper D., Antonenka U., Heesemann J., Rakin A.;
RT   "Complete genome sequence of Yersinia enterocolitica subsp. palearctica
RT   serogroup O:3";
RL   J. Bacteriol. 193(8):2067-2067(2011).
XX
DR   MD5; 67e0656010c5e916b93a76271d5ceccb.
DR   BioSample; SAMEA2271938.
DR   EuropePMC; PMC3133053; 21296963.
DR   EuropePMC; PMC3161016; 21733159.
DR   EuropePMC; PMC3469391; 22963272.
DR   RFAM; RF00042; CopA.
DR   StrainInfo; 163438; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..72460
FT                   /organism="Yersinia enterocolitica subsp. palearctica Y11"
FT                   /plasmid="pYV03"
FT                   /strain="Y11"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:930944"
FT   CDS             complement(1544..2269)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0001"
FT                   /product="ISPsy4, transposition helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78097"
FT                   /protein_id="CBY78097.1"
FT                   /translation="MERHECIEILKQLKLTAMAENFDDVVIDGIRRKRSTMDIIGNLLT
FT                   TEQTQRHIRSIGYRINQARFPQHKTLSDFEFEQSPLNKPSIELLNDCDYIREKRNIIFV
FT                   GGPGTGKTHLATALGINAATNGFKVRFWNVLDLVNKLELDKESKQFKLTNQLTKLDLIV
FT                   LDDLGYLPFSQKGGALLFHLISQLHEHTSIMITTNLAFSEWVKLFSDEKMTAALLDRLV
FT                   HHCDIIETGNESFRFKNRS"
FT   CDS             complement(2256..3758)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0011"
FT                   /product="transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78098"
FT                   /protein_id="CBY78098.1"
FT                   /translation="MLCMETILKVRRLSLKQGLSQRAIAKQLQISRHTVSKYLAIETKE
FT                   PPAYKRTQTHYPKLGEFIPVLKQRLTDETKLPAKQRLTARRHFERLRTEGYQGAYCAVA
FT                   SFIRQFKEQYQPAPHVVFIPQRFSAADAYQFDWSFETVKLNGLLVKLKVAHFRLCHSRA
FT                   FFIRAYPNEKLDMLIDAHNHAFSYFGGTPNRGIYDNMKTAVKHIGMGKERIFNDKFLSM
FT                   MNHFIIEPVACTPASGWEKGQVERQVRTLQKQLFEPTLAFNNIDELNSFLLDQCHQIIQ
FT                   TATHPEDRSKVINTLFCVERTMLAPYSPYTGGQFAIVQINSLSCFDGHKYSVPNNLAGK
FT                   KVTLKTTATEIKIIVDSECVAQHQRSFIKNQTTYNPWHYLSTLKRKPGALRNGEPFINW
FT                   DLPKPVKELQQHLLKRPKGDRAMVQLLSLLADYGEDLGVTAAAIALDEGVPTVEAVLNI
FT                   IHRLTEPVIPTFKINDIPLNIPPQANCQRYNTLLKGVPNGTA"
FT   CDS             3991..4458
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78099"
FT                   /protein_id="CBY78099.1"
FT                   /translation="MINTTFTELLQKIASHFGLDKLSQDEYGLCELILNDRVVIMLRAD
FT                   EILNRLTLLGPILGFSGPEARSTASQLFFCYSINALNKDGPCFAWSEELGLIAFKHLSL
FT                   GELNVENVSKEIANFYDWLSLVSLPAETQQELPPHTQSTQSTQSTQSVKWG"
FT   CDS             4466..6655
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0031"
FT                   /product="type III secretion injected virulence protein
FT                   (YopO,YpkA,serine-threonine kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78100"
FT                   /protein_id="CBY78100.1"
FT                   /translation="MKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRIIDNQV
FT                   LRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTETLHAAQKTTSQELRSDIPNALSNL
FT                   FGAKPQTELPLGWKGKPLSGAPDLEGMRVAETDKFAEGESHISIIETKDNQRLVAKIER
FT                   SIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRCSDT
FT                   LRSLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGIVHNDIKPGNVVFDRASGE
FT                   PVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHGIEGFEKDP
FT                   EIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDSNEA
FT                   RLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSDLLRTHLSSAAT
FT                   KQLDMGVVLSDLDTMLVTLDKAEREGGVDKDQLKSFNSLILKTYSVIEDYVKGREGDTK
FT                   SSSAEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVLVTL
FT                   SPQGQPVSSETYSFLNRLAEAKVTLSQQLDTLQQQQESAKAQLSILINRSGSWADVARQ
FT                   SLQSFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTADSIPLLIRL
FT                   GRSSLIDEHLVEQREKLRELTTIAERLNRLEREWM"
FT   CDS             7284..7400
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78101"
FT                   /protein_id="CBY78101.1"
FT                   /translation="MLPVCSGFTHQRLNVLLQGTVYPEYKIHTAVNSLNKDK"
FT   CDS             7401..8267
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0051"
FT                   /product="type III secretion injected virulence protein
FT                   (YopP,YopJ, induces apoptosis, prevents cytokine
FT                   induction,inhibits NFkb activation)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78102"
FT                   /protein_id="CBY78102.1"
FT                   /translation="MIGPISQINSFGGLSEKETRSLISNEELKNIIIQLETDIADGSWF
FT                   HKNYSRLDIEVMPALVIQANNKYPEMNLNFVTSPQDLSIEIKNVIENGVGSSRFIINMG
FT                   EGGIHFSVIDYKHINGKTSLILFEPVNFNSMGPAILAISTKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSLALAKKLYTERDSLLKIHEDNIKGILSDSENPLPHNKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIFNRFDNNKSIIDGKELSVSVHKKRIAE
FT                   YKTLLKV"
FT   CDS             complement(8791..9528)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0061"
FT                   /product="IncF plasmid conjugative transfer surface
FT                   exclusion protein TraT"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78103"
FT                   /protein_id="CBY78103.1"
FT                   /translation="MKKNMKLIAITAVLSSVLVLSGCGAMSTAIKKRNLEVKTQMSETI
FT                   WLEPSSQKTVYLQIKNTSDKNMLGLAPKITKAVQDKGYTVTSSPEDAHYWIQANVLKAD
FT                   KMDLREAEGFLSQGYQGAALGAALGAGITGYNSNSAGASLGVGLAAGLVGMVADAMVED
FT                   INYTMVTDVQISEKTDTPLQTDNVAALKQGTSGYKVQTSTQTGNKHQYQTRVVSSANKV
FT                   NLKFEEAQPVLEDQLAKSIANIL"
FT   CDS             complement(9675..9866)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0071"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78104"
FT                   /protein_id="CBY78104.1"
FT                   /translation="MKEIAKRVHHIYCLLKLNIRRKGKQRLPACNPSQLAVPERLNLSG
FT                   SVDFMHNALIGGGHFSTL"
FT   CDS             complement(10010..10558)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0081"
FT                   /product="type III secretion negative modulator of
FT                   injection (YopK,YopQ,controls size of translocator pore)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78105"
FT                   /protein_id="CBY78105.1"
FT                   /translation="MFIKDAYNMRALCTALEQSAPDTIINTSKEENNSYYCTTAHLLRT
FT                   DVCSLVNRVGIEPLKSGSILSTLEELWQAVGIIYRLYEWQHVSDIDTNFKKLPNNSDFG
FT                   LVFSVLDCDIGYVITGKKDSKGNIELYDPKNSLLIENDDIKKYLYDENFHRFCIMLIIS
FT                   KSELEELSRESCDQKCIMG"
FT   CDS             11079..12047
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0091"
FT                   /product="type III secretion injected virulence protein (EC
FT                   3.4.22.-,YopT,cysteine protease,depolymerizes actin
FT                   filaments of cytoskeleton,causes cytotoxicity)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78106"
FT                   /protein_id="CBY78106.1"
FT                   /translation="MDSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSHS
FT                   NRQKKLSATIKHNQSSRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRE
FT                   SVANYGGNINFKFAQTKGAFLHQIIKHSDTASGVCEALCAHWIWSHAQGQSLFDQLYVG
FT                   GRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKKGISERMIERHCLLRPVDVTG
FT                   TTESEGPDQLLNAILDTHGIGYGYKKIYLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFH
FT                   FSDKEKFRKWFTNSFWENSMYHYPLGVGQRFSVLTFDSKEV"
FT   CDS             12047..12439
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0101"
FT                   /product="type III secretion chaperone protein for YopT
FT                   (SycT)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78107"
FT                   /protein_id="CBY78107.1"
FT                   /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQ
FT                   QWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKSILWSQQSLVGLDIDEMQAWLERF
FT                   IDDIEQRKEPQNTKFQPNSTSPILFI"
FT   CDS             complement(12483..12611)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0111"
FT                   /product="ORF61 (o129)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78108"
FT                   /protein_id="CBY78108.1"
FT                   /translation="MVMLYVKTWINNKNFLIYSELKTNELLYKPYLLKLIDIIVTM"
FT   CDS             complement(12639..12872)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0121"
FT                   /product="ORF61 (o129)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78109"
FT                   /protein_id="CBY78109.1"
FT                   /translation="MQQPVYFPSFSFHDNSIFCNKPIVGTMNINADYEKSLKVSIIYKI
FT                   QPIGGITEILNGGLLTGGDLTWQDISINCLYH"
FT   CDS             13074..13217
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0131"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78110"
FT                   /protein_id="CBY78110.1"
FT                   /translation="MKKARFTETQIVNILKLADSGMKVEEICRQNGISNATYYNWKSKY
FT                   GS"
FT   CDS             13177..13335
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0141"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78111"
FT                   /protein_id="CBY78111.1"
FT                   /translation="MRPIIIGNPSMEADDVKRLKELEDENARLKKLFAEVSLENHAMKE
FT                   LFAKKGW"
FT   CDS             13583..13981
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0151"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78112"
FT                   /protein_id="CBY78112.1"
FT                   /translation="MYCRLGLNLKRKVKKTLPKREKNPLSVVNKPNIQWAMDFVHDALY
FT                   CGKRFRTLNIIDEGTRECLAIEVDTSLPANRVIRVLERLKEERGQPQQIRVDNGPELIS
FT                   VNLLNYCEYNGITLCHIQPGKPAAEWIH"
FT   CDS             14013..14162
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0161"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78113"
FT                   /protein_id="CBY78113.1"
FT                   /translation="MDAYLCQVREMVWFWQQDYNLNRTHESLEHLPPETYRKQLENSNQ
FT                   VCLK"
FT   CDS             14285..14647
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0171"
FT                   /product="type III secretion negative regulator of effector
FT                   production protein (LcrQ,YscM, YscM1 and YscM2)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78114"
FT                   /protein_id="CBY78114.1"
FT                   /translation="MGGIMEINDLQSLISMQIAEFGGGEKIGRLKSTLQQVSTQAITSD
FT                   ERRFAYAVLEHAKNTILNRQDVAKLLPRASNFELSQGKKGEVILKGLRVEQLSLEDAKL
FT                   LLDAVTRKCKSFNITT"
FT   CDS             14925..15080
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0181"
FT                   /product="transposase for transposon Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78115"
FT                   /protein_id="CBY78115.1"
FT                   /translation="MLEGLLEQETGLNPTEIMTDTAGVSDLVFGLFWLLGYQFSPRLAD
FT                   AGASVL"
FT   CDS             15084..15728
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0191"
FT                   /product="transposase for transposon Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78116"
FT                   /protein_id="CBY78116.1"
FT                   /translation="MDHDADYGVLNDIARGQSDPRKIVLQWDEMIRTAGSLKLGKVQAS
FT                   VLVRSLLKSERSSGLTQAIIEMGRINKTLYLLNYIDDEDYRRRILTQLNRGESRHAVAR
FT                   AICHGQKGEIRKRYTDGQEDQLGALGLVTNAVVLWNTIDMQPALDHLRAQGETLNDEDT
FT                   ARLSPLCHGHINMLGHYSFTLAELVTKRRSETIKRGVRGRKRCLTWFFSFH"
FT   CDS             complement(15740..15892)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0201"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78117"
FT                   /protein_id="CBY78117.1"
FT                   /translation="MKLEFIKPGKPTQNAFIERFNRTYRTEILDFYLFRTLNEVREITD
FT                   KWLYE"
FT   CDS             complement(15908..16093)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78118"
FT                   /protein_id="CBY78118.1"
FT                   /translation="MHDALICVDDYNRETLAIEIDLNLPTQHVIRVLDRIVANRGYPVM
FT                   LRMDNGPEFISLALAK"
FT   CDS             16908..18320
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78119"
FT                   /protein_id="CBY78119.1"
FT                   /translation="MTKDFKISVSAALISALFSSPYAFADDYDGIPNLTAVQISPNADP
FT                   ALGLEYPVRPPVPGAGGLNASAKGIHSIAIGATAEAAKGAAVAVGAGSIATGVNSVAIG
FT                   PLSKALGDSAVTYGAASTAQKDGVAIGARASTSDTGVAVGFNSKADAKNSVAIGHSSHV
FT                   AANHGYSIAIGDRSKTDRENSVSIGHESLNRQLTHLAAGTKDTDAVNVAQLKKEIEKTQ
FT                   ENTNKRSADLLANANAYADNKSSSVLGIANNYTDSKSAETLENARKEAFAQSKDVLNMA
FT                   KAHSNSVARTTLETAEEHANSVARTTLETAEEHANSVARTTLETAEEHANKKSAEALAS
FT                   ANVYADSKSSHTLKTANSYTDVTVSNSTKKAIRESNQYTDHKFRQLDNRLDKLDTRVDK
FT                   GLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIGSGYRVNENVALKAGVAYAGSS
FT                   DVMYNASFNIEW"
FT   CDS             18390..19265
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0231"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78120"
FT                   /protein_id="CBY78120.1"
FT                   /translation="MLMKNFLVILLFIMVSVTWGTTWLAMKLTVETIPPIFATGIRFML
FT                   AAPVLILISVLTKTRLLFPDGQKFFQLFVCIFYFSIPFSLMIYGETYVSPALASIIFSS
FT                   MPVCVLFFSWLLLNERVGIIAILGLVTSTVSLLAILFIETNIGSNNQWVGIISLVIAVI
FT                   MHALVYVQCKKRSCSVSVLTFNAIPSLVAGILLCIVGWIAEQPVISKFSQQSLLSVIYL
FT                   GIIAGVFGILCYFQLQNKASAFQASTVFLVFPIIALLLDGYVYGRYFSLYSILLIIPLL
FT                   TGVLLISLRK"
FT   CDS             19858..20265
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78121"
FT                   /protein_id="CBY78121.1"
FT                   /translation="MIDSHDAADLATLLAMLVSTESVAARLNDAVHKLVGTAAEMVLSG
FT                   SRYADAPVLPGDGTHITFPYAGEWLTEAEILAVTEGIRHAVRDVCTQVVEDVRRRIGGP
FT                   LGKRKISYAKPVFCTDCCLLSVMNGISPVPA"
FT   CDS             complement(20195..21046)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0251"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78122"
FT                   /protein_id="CBY78122.1"
FT                   /translation="MPRRQILSSEEKERLLVVPDDDVLLTRMCFLSEHDLALINKHRRP
FT                   ANRLGFAVLLCYLRGPGFPPDKNISPHDGVVSRLAAHLKLQPDLWAEYASREVTRWEHL
FT                   AELYRYLELSPFNRALQKACIRHLYPKQNGLAKALREIGRIERSLFMLDWFRDPSLRRR
FT                   VQAGLNKGEARNALARAVFMHRLGEIRDRGLENQSYRASGLTLLTAAISLWNTVYIERA
FT                   IDSLKRKGIPFNDQLISHLSPLGWEHINLSGDYVWRTNLKLGQGKYRSLRSVDSSLYKK
FT                   QA"
FT   CDS             21372..21788
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0261"
FT                   /product="transposon resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78123"
FT                   /protein_id="CBY78123.1"
FT                   /translation="MLDRMENGDVLIVTKLDRLGRNAMDIRKTVEQLAVSEIRVHCLAL
FT                   GGVDLTSAAGKMTMQVISAVAEFERDLLLERTYSGIARARASGKRFGRPSALTEAQKRA
FT                   VMESLNAGSSVSAVAREFNTTRQTILRVKAAFSP"
FT   CDS             complement(21802..22227)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0271"
FT                   /product="arsenate reductase (EC 1.20.4.1)"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78124"
FT                   /protein_id="CBY78124.1"
FT                   /translation="MSNITIYHNPTCGTSRNTLEMIRNSSNEPTVIYYLETPPTHDELV
FT                   KLIADMGITVRALLRKNVEPYEELGLAEGTFSDEQLIGFMLEHPILINRPIVVTPLGTR
FT                   LCRPSEVVLDILPEPQQGAFTKEDGEKITSQVNDSNN"
FT   CDS             complement(22240..23529)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0281"
FT                   /product="arsenic efflux pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78125"
FT                   /protein_id="CBY78125.1"
FT                   /translation="MLLAGSIFVLTLILVIWQPRGLSIGWSASIGAALALVSGVIHVGD
FT                   IPVVWNIVWNATATFIAVIIISLLLDESGFFEWAALHVSRWGNGRGRLLFTWIVLLGAA
FT                   VAALFANDGAALILTPIVIAMLLALGFSKRTTLAFVMAAGFIADTASLPLIVSNLVNIV
FT                   SADFFRLGFTEYASVMLPVDIAAIAATLGMLHLFFRRDIPATYDVSLLKMPASAIKDPA
FT                   TFRAGWIVLVLLLVGFFVLEPLGIPVSAIAAVGTVVLFAVAKKGHAINTGKVLRGAPWQ
FT                   IVVFSLGMYLVVYGLRNAGLTEYLSGVLNMLADKGLLAATFGTGFLTAFLSSVMNNMPT
FT                   VLVGALSIDGSTASGVIKEAMIYANVIGCDLGPKITPIGSLATLLWLHVLSQKNMTISW
FT                   GYYFRTGIIMTLPVLFVTLAALALRLSVTL"
FT   CDS             complement(23575..23751)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0291"
FT                   /product="arsenical resistance operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78126"
FT                   /protein_id="CBY78126.1"
FT                   /translation="MAILREAELVLDRREGKWVHYRLSPHMPAWAAETITTSWHCLRED
FT                   VRQWLDKSAASSC"
FT   CDS             23981..24679
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0301"
FT                   /product="arsenic resistance protein ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78127"
FT                   /protein_id="CBY78127.1"
FT                   /translation="MEQFPALNTECFDRQIAERLQHPTPPRILILYGSVRERSYSRFAA
FT                   EEAGRLLTAMGAEVKTFNPSGLPLPDDAPETHPKVTELRELVRWCDGMVWSSPERHGAM
FT                   SAIMKAQIDWIPLSEGAVRPSQGKTLAVMQVCGGSQSFNAVNQMRILGRWMRMFTIPNQ
FT                   SSVAKAWQEFDENGRMKPSSWYDRIVDVAEELFKITLLLKGHTEYLADRYSERKESHQE
FT                   LSARVNQAKI"
FT   CDS             complement(24894..25007)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78128"
FT                   /protein_id="CBY78128.1"
FT                   /translation="MQWPATGSPSEPPDRCPDVAAHARFFRYLTARQDPTI"
FT   CDS             25222..25344
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0321"
FT                   /product="IncF plasmid conjugative transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78129"
FT                   /protein_id="CBY78129.1"
FT                   /translation="MSAWWEDAQFAGLQASRNGQTLVADSVHFPLFETNLIRVF"
FT   CDS             complement(25312..25461)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0331"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78130"
FT                   /protein_id="CBY78130.1"
FT                   /translation="MDAYLCQVREMVWFWQQDYNLNRTHESLEHLPPETYRKQLENSNQ
FT                   VCLK"
FT   CDS             complement(25493..26005)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0341"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78131"
FT                   /protein_id="CBY78131.1"
FT                   /translation="MIDAIHVVLSESPQAGFWKCYYRLRFKGYIFNHKRVYRVYCRLGL
FT                   NLKRKVKKTLPKREKNPLSVVNKPNIQWAMDFVHDALYCGKRFRTLNIIDEGTRECLAI
FT                   EVDTSLPANRVIRVLERLKEERGQPQQIRVDNGPELISVNLLNYCEYNGITLCHIQPGK
FT                   PAAEWIH"
FT   CDS             complement(26141..26269)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0351"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78132"
FT                   /protein_id="CBY78132.1"
FT                   /translation="MEADDVKRLKELEDENARLKKLFAEVSLENHAMKELFAKKGW"
FT   CDS             complement(26259..26402)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0361"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78133"
FT                   /protein_id="CBY78133.1"
FT                   /translation="MKKARFTETQIVNILKLADSGMKVEEICRQNGISNATYYNWKSKY
FT                   GS"
FT   CDS             26715..26933
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78134"
FT                   /protein_id="CBY78134.1"
FT                   /translation="MSLVTYELAAPSSSYFDFAQAVAIRRMALNLSDQPAYLLESETTL
FT                   QLENIPDLCKCMLFDFLWNTVHASMKP"
FT   CDS             26900..27022
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78135"
FT                   /protein_id="CBY78135.1"
FT                   /translation="MEHGTRINEALAVTPKDIVIGRGKAFCGAAHFKEAKSNGR"
FT   CDS             complement(26994..27437)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0391"
FT                   /product="putative integrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78136"
FT                   /protein_id="CBY78136.1"
FT                   /translation="MLWGLFDNELHIEFEGEWIGSYYPVSGPILLNRYRAFRKGAISQW
FT                   AERIRTLAQQLSLPIAALTGENIALISQSETYDIPRQSLPAATEECYASTIMAKLAIAN
FT                   ELATPLAKLTSSDRHFIEQKHHSFHWRIFSWAAAFTGRLISLL"
FT   CDS             complement(27418..27531)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78137"
FT                   /protein_id="CBY78137.1"
FT                   /translation="MPKSLNAAKWVSIARIMAEGTAYEVESDLCFIALGTV"
FT   CDS             28080..29246
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0411"
FT                   /product="chromosome (plasmid) partitioning protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78138"
FT                   /protein_id="CBY78138.1"
FT                   /translation="MNLKSTLDRCIERGQFMTQEIAKSQFGNDSPAARTITRRWRITEA
FT                   AELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDMRDVFKTRLSKPKGE
FT                   NPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQATASLYHGYVPDLHIH
FT                   EEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIYSLHDQGKLPVAPHL
FT                   LLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQFFTML
FT                   RDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGMVLKEVVRVTDEVGK
FT                   GQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRWENA"
FT   CDS             29243..30208
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0421"
FT                   /product="chromosome (plasmid) partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78139"
FT                   /protein_id="CBY78139.1"
FT                   /translation="MMKRSAVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
FT                   KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSG
FT                   QQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQVANEYRPTS
FT                   AYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAELPLKTIQLFANPNELSA
FT                   RSGEALNKAYENNVDALKRVTHKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKSFG
FT                   KNIEAKYSKDNVSFYLKSAPESLVKQIEELLNTYAKEHSL"
FT   CDS             30350..30469
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78140"
FT                   /protein_id="CBY78140.1"
FT                   /translation="MALDIQVGPWSQLLTLVLDIQVGPWSQLPTLALDIQVEM"
FT   CDS             30744..30947
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0441"
FT                   /product="putative transposase remnant"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78141"
FT                   /protein_id="CBY78141.1"
FT                   /translation="MMTEHGISVEHSTLHSWVIRVVPLLHKAFCRYKCTVGRRWRMDET
FT                   SKVSGNTCTGRLILAVRLSIFC"
FT   CDS             31091..31333
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0451"
FT                   /product="Orf73 (o91); similar to gi|1806202"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78142"
FT                   /protein_id="CBY78142.1"
FT                   /translation="MARVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQ
FT                   RVQHVRDMVLAGTNAPVSHRLMDEIFSAAVKDTSV"
FT   CDS             31326..31625
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0461"
FT                   /product="ParE toxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78143"
FT                   /protein_id="CBY78143.1"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   LELGAECNWICSDMRRFQYKKHGIYYITLSNDILISRVLHQSIDIDAQDFPEYE"
FT   CDS             complement(31765..32349)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0471"
FT                   /product="type III secretion injected virulence protein
FT                   (YopE)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78144"
FT                   /protein_id="CBY78144.1"
FT                   /translation="MSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSV
FT                   IGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETL
FT                   QKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAA
FT                   SAYVASGVDLTQAANEIKGLGQQMQQLLSLM"
FT   CDS             32617..33009
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0481"
FT                   /product="type III secretion chaperone protein for YopE
FT                   (SycE)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78145"
FT                   /protein_id="CBY78145.1"
FT                   /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQ
FT                   ILMFTLPSLDNNNEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLY
FT                   TQLEMLVQGAERLQTSSLISPPRSFS"
FT   CDS             33287..33556
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0491"
FT                   /product="transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78146"
FT                   /protein_id="CBY78146.1"
FT                   /translation="MRLAQLVLEQHYTVAAAATAMNVGKSTMNKWVRQLKEERAGKSPI
FT                   ASPMTPEQIEIRELKKRLQRVEMERDILKKATALLMSDSLNNFH"
FT   CDS             33592..33762
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0501"
FT                   /product="COG2801: transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78147"
FT                   /protein_id="CBY78147.1"
FT                   /translation="MCNVFGVHRSSYKYWWQPRKPDATRVALLSLVREVYRESNGSAGA
FT                   RSIAAMVPPKG"
FT   CDS             33689..33841
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78148"
FT                   /protein_id="CBY78148.1"
FT                   /translation="MKFIAKVTVQQEHEALPQWSHQRDKTEPLAGNKADESAQYYQLSA
FT                   TWPSL"
FT   CDS             33792..34295
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0521"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78149"
FT                   /protein_id="CBY78149.1"
FT                   /translation="MKALNIISCQQPGHRYKKASKEHIEIPNYLDRQFAVTEPNQAWCG
FT                   DVTYIWTGKRWAYLAVVLDLFSRKPVGWAMSFFPDSALTGKALSMAWEARGKPANLLYH
FT                   SDQGSHYTSRNFRQLLWRYQIKQSLSRRGNCWDNSPMERFFRSLKTEWVPDNGYANFSE
FT                   ASTA"
FT   CDS             34622..35047
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0531"
FT                   /product="putative yopH targeting protein SycH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78150"
FT                   /protein_id="CBY78150.1"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGAK
FT                   LASVLTSLVDKAVTLSCEPTMKKEDDDHRPSSSHLLV"
FT   CDS             complement(35275..36681)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0541"
FT                   /product="type III secretion injected virulence protein
FT                   (YopH,tyrosine phosphatase of FAK and p130cas, prevents
FT                   phagocytosis)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78151"
FT                   /protein_id="CBY78151.1"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANIVLTQEDTAKLLQSTVKHNLNNYELRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSVLHAPGTPVREGLRSHLDSRTPPLPP
FT                   RERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIATQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVADDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
FT   CDS             complement(37366..37713)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0551"
FT                   /product="type III secretion negative regulator of effector
FT                   production protein (LcrQ,YscM, YscM1 and YscM2)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78152"
FT                   /protein_id="CBY78152.1"
FT                   /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKA
FT                   FASEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLE
FT                   AAMRQDTAADG"
FT   CDS             complement(37932..38570)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0561"
FT                   /product="type III secretion cytoplasmic protein (YscL)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78153"
FT                   /protein_id="CBY78153.1"
FT                   /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEK
FT                   ILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVR
FT                   KILNDYDQVDMTLQVVREALALVSNQKQVVVRVNPDQAGTIREQIAKVHKDFPEISYLE
FT                   VTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTEEE"
FT   CDS             complement(38549..39175)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0571"
FT                   /product="type III secretion cytoplasmic protein (YscK)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78154"
FT                   /protein_id="CBY78154.1"
FT                   /translation="MENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLNA
FT                   ALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQLLT
FT                   LVNQETLRQIIVQHELLIGPWPTNWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQAWCK
FT                   RLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVMPTCSHLFK"
FT   CDS             complement(39178..39810)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0581"
FT                   /product="type III secretion bridge between inner and
FT                   outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78155"
FT                   /protein_id="CBY78155.1"
FT                   /translation="MLALLRQEGLSADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPH
FT                   ESFSTLQDVFPKDGLISSPIEELARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNN
FT                   KGKKGVAASASVFIKHAADIQFDTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSS
FT                   HLPRNTSILSIQVSEESKGRLIGLLSLLILLLPVTNLAQYFWLQRKK"
FT   CDS             complement(39919..40266)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0591"
FT                   /product="type III secretion cytoplasmic protein (YscI)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78156"
FT                   /protein_id="CBY78156.1"
FT                   /translation="MSNIEIAQADEVIITTLEEFGPVEPTTEQIMRFDAAMSEDTQGLG
FT                   HSLLKEVSDIQKTFKTAKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRM
FT                   SQNVETLSKGG"
FT   CDS             complement(40267..40764)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0601"
FT                   /product="type III secretion effector protein (YopR,encoded
FT                   by YscH)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78157"
FT                   /protein_id="CBY78157.1"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPAASELKTQLEHKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLATPVREALLARFGQHQGPVVPAIDLPELRSVLQQFD
FT                   SFGKRREAILLQVLEGIKPNESQVGLPYLSELINKELMILLPYNSIVDSLLHNSHQIDM
FT                   DT"
FT   CDS             complement(40761..41108)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0611"
FT                   /product="type III secretion spans bacterial envelope
FT                   protein (YscG)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78158"
FT                   /protein_id="CBY78158.1"
FT                   /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLIQ
FT                   LSSLMNRGDYASALQQGNKSAYPDLEPWLALCEYRLGLGNALESRLNRLATSQDPRIQT
FT                   FVNGMREQLKT"
FT   CDS             complement(41110..41373)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0621"
FT                   /product="type III secretion cytoplasmic protein (YscF)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78159"
FT                   /protein_id="CBY78159.1"
FT                   /translation="MSNFPGFAKGTDITDLDAVAQTLKKPADDANKAVNDSIAALKDTP
FT                   DNPALLADLQHSINKWSVIYNMSSTIVRSMKDLMQGILQKFP"
FT   CDS             complement(41370..41573)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0631"
FT                   /product="type III secretion protein (YscE)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78160"
FT                   /protein_id="CBY78160.1"
FT                   /translation="MTQLEEQLHNVETVRSITMQLEMALAKLKKDMMRGGDAKQYQVWQ
FT                   SESKAIESAIAIIHYVTGDLKK"
FT   CDS             complement(41570..42241)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0641"
FT                   /product="type III secretion inner membrane protein
FT                   (YscD,homologous to flagellar export components)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78161"
FT                   /protein_id="CBY78161.1"
FT                   /translation="MSLQNFLESHGIPFRLELRSMEELRQGAEFILQRLGYHGIEVSLA
FT                   PQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVENKVRIAGNQRKRLDALLEQFGLD
FT                   SDFTVNVKGELIELRGQVNDEKLSSFNQLQQTFRQEFGNRPKLELVNVGGQPQHDELNF
FT                   EVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDAVIVSKGKREFVIQLNGGKP
FT                   R"
FT   CDS             42202..42849
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78162"
FT                   /protein_id="CBY78162.1"
FT                   /translation="MECHGSQENFAVTSGHDYPGYNQLITKVHPLWAMLKRHPCRQQLP
FT                   ASAVLLAQQVVHPGYTRATIRALASPKKSKATIKKELQAQPQVVNEVTCRLALFSAWEP
FT                   VTSLAKVALRRQMSTVKTLLPDKCPREEESPTAREALLVVEVLQNQLGEYLLHRPSALN
FT                   ARVLFRCQKEQYLIATGLSQKHSAHEEAQLQHHGASLDKNDRPNSQYATLRC"
FT   CDS             complement(42823..44646)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0661"
FT                   /product="type III secretion outermembrane pore forming
FT                   protein (YscC,MxiD,HrcC, InvG)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78163"
FT                   /protein_id="CBY78163.1"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSSYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLTDFGANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKQALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQAATRASAQARVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLVDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHSETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIEGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYIGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGQDLRTGILTVDEISNQSTTLNKLLGGSQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAQSWCVSAPKRGVL"
FT   CDS             complement(44652..45065)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0671"
FT                   /product="type III secretion chaperone protein for YopN
FT                   (SycN,YscB)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78164"
FT                   /protein_id="CBY78164.1"
FT                   /translation="MQNLLKNLATSLGRKPFVADKQGVYRLTIDKHLVMLTPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
FT   CDS             complement(45256..45405)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78165"
FT                   /protein_id="CBY78165.1"
FT                   /translation="MKIQWDEPNYNETYNSIISPLDGNNMLFNNQDSLSGLLSAVAQET
FT                   SAIK"
FT   CDS             complement(45468..46283)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0691"
FT                   /product="type III secretion thermoregulatory protein
FT                   (LcrF,VirF,transcription regulation of virulence plasmid)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78166"
FT                   /protein_id="CBY78166.1"
FT                   /translation="MASLEIIKLEWATPIFKVVEHSQDGLYILLQGQISWQNSSQTYDL
FT                   DEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIRRDNATPKPL
FT                   LIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRHLGN
FT                   RPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAH
FT                   QLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
FT   CDS             complement(46407..46709)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0701"
FT                   /product="type III secretion transporter lipoprotein
FT                   (YscW,VirG)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78167"
FT                   /protein_id="CBY78167.1"
FT                   /translation="MSRPLSRTAHIDVSIFGLYEGKVREVQRTRFETGNLPLFFSIKLN
FT                   PAQRGEGELYLRSTLSFPERGVQAVAQQKLIGKNKVVLQMIPKTCYPNCQSPNTR"
FT   CDS             complement(47378..48442)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0711"
FT                   /product="type III secretion inner membrane protein
FT                   (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export
FT                   components)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78168"
FT                   /protein_id="CBY78168.1"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTTLIVALSAMLMGL
FT                   SDYYFEHLSRLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
FT   CDS             complement(48442..49227)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0721"
FT                   /product="type III secretion inner membrane protein
FT                   (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export
FT                   components)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78169"
FT                   /protein_id="CBY78169.1"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEFILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFCGGAFLSLLSALFHSYVNWPVASFFP
FT                   EVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
FT   CDS             complement(49224..49490)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0731"
FT                   /product="type III secretion inner membrane protein
FT                   (YscS,homologous to flagellar export components)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78170"
FT                   /protein_id="CBY78170.1"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
FT   CDS             complement(49492..50145)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0741"
FT                   /product="type III secretion inner membrane protein
FT                   (YscR,SpaR,HrcR,EscR,homologous to flagellar export
FT                   components)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78171"
FT                   /protein_id="CBY78171.1"
FT                   /translation="MIQLPDEINLIIILSLLTLLPLVSVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
FT   CDS             complement(50142..51065)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0751"
FT                   /product="type III secretion inner membrane protein
FT                   (YscQ,homologous to flagellar export components)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78172"
FT                   /protein_id="CBY78172.1"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYRQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGDDLANWLTPDLLGAPFSTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILLSLRW
FT                   HKVYLTLDEVDSLRLGDVLLVPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPKPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
FT   CDS             complement(51062..52609)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0761"
FT                   /product="type III secretion protein (YscP)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78173"
FT                   /protein_id="CBY78173.1"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHDLQARADFEQALLHNNKGNRHPK
FT                   EEPRRPVRPHDLGKKEGQKGDGLRAHAPLEATFQPGRKEVGLKPQHNHQNNHDLNLSPL
FT                   AEGVTNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHDELF
FT                   VQQSPIDSVQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQKRLAE
FT                   EPLPLHQEALPEVCPPAVSATPNDHLVARWCATPVAEVAEKSARFLHKAIVQSEQLDMT
FT                   ELADRSQHLTDGVDSSKDTIELPRPEEPLPLHQEALPEVAEKSARFPHKATVQSEQLDM
FT                   TELAARSQYLTDGVDSSKDTIEPPRPEELLLPREETLLEMYSLSFTAPVVTPGDHLLAT
FT                   MRATRLTSVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHV
FT                   ELIASQEALRILAQGSYDLLERLQRIEPTQLDFQASGDSEQESRQKRHVYEEWEAEE"
FT   CDS             complement(52609..53073)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0771"
FT                   /product="type III secretion spans bacterial envelope
FT                   protein (YscO)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78174"
FT                   /protein_id="CBY78174.1"
FT                   /translation="MIRRLHRVKVLRVERAEQAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLECLANERERL
FT                   TLCQKTLQQARHKENKFLELVQREDENELNQQHYQEEQEQEEFLQHHRNA"
FT   CDS             complement(53070..54389)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0781"
FT                   /product="type III secretion cytoplasmic ATP synthase (EC
FT                   3.6.3.14, YscN,SpaL,MxiB,HrcN,EscN)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78175"
FT                   /protein_id="CBY78175.1"
FT                   /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIG
FT                   ELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLL
FT                   GQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQ
FT                   RMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLV
FT                   VATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTR
FT                   RGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSR
FT                   KLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQ
FT                   DKEADQAIERIGAIRGWLCQGTHELSHFNETLNLLETLTQ"
FT   CDS             54587..55468
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0791"
FT                   /product="type III secretion outermembrane contact sensing
FT                   protein( yopN,Yop4b,LcrE)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78176"
FT                   /protein_id="CBY78176.1"
FT                   /translation="MTTLHNLSYGNTPLRNEHPEIASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELKQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLLHLVEQAL
FT                   VSMVEEQEEAIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGINAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSEREKLEIVISDLQKLKEFRSVSDQVKGFWQL
FT                   FSEGITNGLRPF"
FT   CDS             55449..55727
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0801"
FT                   /product="type III secretion outermembrane negative
FT                   regulator of secretion (TyeA)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78177"
FT                   /protein_id="CBY78177.1"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
FT   CDS             55804..56085
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0811"
FT                   /product="putative type III secretion protein SycN"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78178"
FT                   /protein_id="CBY78178.1"
FT                   /translation="MAQSGTLQLEQHGATLTLWLARSLAWHQCEDAMVKALTLTAAQKS
FT                   GALPLRAGWLGENQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLAP"
FT   CDS             56082..56450
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0821"
FT                   /product="putative type III secretion protein YscX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78179"
FT                   /protein_id="CBY78179.1"
FT                   /translation="MSRIITAPHIGIEKLSAISLEELSCGLPDRYALPPDGHPVEPHLE
FT                   RLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKC
FT                   QQDDDRLLQIILNLLHKV"
FT   CDS             56447..56791
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0831"
FT                   /product="required for Yop secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78180"
FT                   /protein_id="CBY78180.1"
FT                   /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHLA
FT                   GRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
FT                   LELKDHNESP"
FT   CDS             56778..58892
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0841"
FT                   /product="type III secretion inner membrane channel protein
FT                   (LcrD,HrcV,EscV,SsaV)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78181"
FT                   /protein_id="CBY78181.1"
FT                   /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSILTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYLISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQETFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALDP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRVCL"
FT   CDS             58889..59329
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0851"
FT                   /product="type III secretion low calcium response protein
FT                   (LcrR)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78182"
FT                   /protein_id="CBY78182.1"
FT                   /translation="MMEDPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRVE
FT                   IEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLSTQ
FT                   RLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
FT   CDS             59371..59658
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0861"
FT                   /product="type III secretion cytoplasmic plug protein
FT                   (LcrG)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78183"
FT                   /protein_id="CBY78183.1"
FT                   /translation="MKSSHFDEYDKTLKQAEMAIADSDHRAKLLQEMCADIGLTPEAVM
FT                   KIFAGRSAEEIKPAERELLDEIKRQRERQPQHPNDGKRPKKPTMMRGQII"
FT   CDS             59660..60634
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0871"
FT                   /product="type III secretion cytoplasmic LcrG inhibitor
FT                   (LcrV,secretion and targeting control protein, V antigen)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78184"
FT                   /protein_id="CBY78184.1"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKKID
FT                   ISIKYDPKKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKHLSNSDTINIHDKSINLMDKNLYGYTNEEIFKASAEYKILEKMSQT
FT                   TIKEGETEKKIVSIKNFLESENKRTGALGNLKDSYSYNKDNNELSHFATTCSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTR"
FT   CDS             60931..61143
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0881"
FT                   /product="type III secretion chaperone protein for YopD
FT                   (SycD)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78185"
FT                   /protein_id="CBY78185.1"
FT                   /translation="MDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKEL
FT                   STRVSSMLEAIKLKKEMEHECVDNP"
FT   CDS             61253..62326
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0891"
FT                   /product="type III secretion host injection protein (YopB)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78186"
FT                   /protein_id="CBY78186.1"
FT                   /translation="MSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLIS
FT                   NYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIK
FT                   ETEENAKQVKKSGMASKIFGWLSAIASVVIGAIMMASGVGAVAGAMMIASGVIGMANMA
FT                   VKQAAEDGLISQEAMQVLGPILTAIEVALTVVSTVMTFGGSALKCLADIGAKLGANTAS
FT                   LAAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFGSLTMSHVIRTGSQATQVAVGVGSG
FT                   ITQTINNKKQADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMI
FT                   NAKGDMLHNLAGRPHTV"
FT   CDS             62345..63265
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0901"
FT                   /product="type III secretion host injection and negative
FT                   regulator protein (YopD)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78187"
FT                   /protein_id="CBY78187.1"
FT                   /translation="MTINIKTDSPIITTGSQLDAITTETVGQSGEVKKTEDTRHEAQAI
FT                   KSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQR
FT                   DIENKATISAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQI
FT                   LNSNIAGRDQLIDTKMQQMSNAGDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDS
FT                   KANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFM
FT                   KDVLRLIEQYVSSHTHAMKAAFGVV"
FT   CDS             63496..63726
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0911"
FT                   /product="ISSod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78188"
FT                   /protein_id="CBY78188.1"
FT                   /translation="MPLIKQLTKVTLTAELDSYLALDIEANRKNGSSRKTVKTPTGTFE
FT                   LATPRDRNGTFEPQLVMGPTIFSGTPVVAEK"
FT   CDS             63781..63996
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78189"
FT                   /protein_id="CBY78189.1"
FT                   /translation="MTNAIESVHRLFRKLTKTKGVFPNENSLLKLLCMGLMNAQEKWTM
FT                   PIQSWNLTLSQLAIYFEGRLDKVITL"
FT   CDS             complement(64040..65143)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0931"
FT                   /product="type III secretion possible injected virulence
FT                   protein (YopM) / internalin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78190"
FT                   /protein_id="CBY78190.1"
FT                   /translation="MFINPRNVSNTFLQEPLRHSSDLTEMPVEAENVKSKAEYYNAWSE
FT                   WERNAPPGNGEQRGMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLT
FT                   ELPELPQSLKSLQVDNNNLKALSDLPPLLEYLGAANNQLEELPELQNSSFLTSIDVDNN
FT                   SLKTLPDLPPSLEFLAAGNNQLEELSELQNLPFLTAIYADNNSLKTLPDLPPSLKTLNV
FT                   RENYLTDLPELPQSLTFLDVSDNIFSGLSELPPNLYNLNASSNEIRSLCDLPPSLVELD
FT                   VRDNQLIELPALPPRLERLIASFNHLAEVPELPQNLKLLHVEYNALREFPDIPESVEDL
FT                   RMDSERVIDPYEFAHETIDKLEDDVFE"
FT   CDS             complement(65524..65655)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78191"
FT                   /protein_id="CBY78191.1"
FT                   /translation="MRNETIEKTKEQMAGIETTSPKYTDLKFNDIAVRLILRPVKTG"
FT   CDS             complement(65652..65777)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78192"
FT                   /protein_id="CBY78192.1"
FT                   /translation="MDSANTYTNNKADSTLKDANNYTTQKVNRDAISGVIDQELH"
FT   CDS             66290..66481
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0961"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78193"
FT                   /protein_id="CBY78193.1"
FT                   /translation="MSIKATLLYSYQEYGQHTDVFIQVKFNYGVIESKFYVNKVKFDNT
FT                   TGQKAQDNDSSLSSAHGA"
FT   CDS             66504..66623
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0971"
FT                   /product="Orf60 (f139)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78194"
FT                   /protein_id="CBY78194.1"
FT                   /translation="MKKRLVIAAALCAAFYAGMKVEHFLTVDACLDCWPSYAE"
FT   CDS             66632..66745
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0981"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78195"
FT                   /protein_id="CBY78195.1"
FT                   /translation="MNVKAIATPPLIKKTKKYPSIKQQLSLSNIIDMSYQM"
FT   CDS             complement(66999..67652)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p0991"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p0991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78196"
FT                   /protein_id="CBY78196.1"
FT                   /translation="MVVTEKKSCAGLLTASGLSVITACKLTSLSRASFCRRRADWREKD
FT                   KAVIDAIHVVLSESPQAGFWKCYYRLRFKGYIFNHKRVYRVYCRLGLNLKRKVKKTLPK
FT                   REKNPLSVVNKPNIQWAMDFVHDALYCGKRFRTLNIIDEGTRECLAIEVDTSLPANRVI
FT                   RVLERLKEERGQPQQIRVDNGPELISVNLLNYCEYNGITLCHIQPGKPAAEWIH"
FT   CDS             complement(67646..67774)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1001"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78197"
FT                   /protein_id="CBY78197.1"
FT                   /translation="MEADDVKKLKELEDENARLKKLFAEVSLENHAMKELFAKKGW"
FT   CDS             complement(67764..67907)
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1011"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78198"
FT                   /protein_id="CBY78198.1"
FT                   /translation="MKKARFTETQIVNILKLADSGMKVEEICRQNGISNATYYNWKSKY
FT                   GS"
FT   CDS             68242..68454
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1021"
FT                   /product="COG1112: Superfamily I DNA and RNA helicases and
FT                   helicase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78199"
FT                   /protein_id="CBY78199.1"
FT                   /translation="MVITDRDGGIVAAVELDDCSHQASHRQRRDLLLEEVLRQADIPLL
FT                   RSKDEGVLVANVQTFLATVEQRQNV"
FT   CDS             68540..68806
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1031"
FT                   /product="IncF plasmid conjugative transfer pilin acetylase
FT                   TraX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78200"
FT                   /protein_id="CBY78200.1"
FT                   /translation="MVAFMAMVGDHIATAFQLDMPLLNLLGRCAFPLFALVSGCNLAGH
FT                   CLRQSSLNRLWLMALLAQLSSAQLSSARVWVSILGGGGSVVDQ"
FT   CDS             69309..69449
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78201"
FT                   /protein_id="CBY78201.1"
FT                   /translation="MRAFHALSRGAAGSRAISQMLRQSGADAGRWLARRPIQECGLTSR
FT                   Q"
FT   CDS             69501..69761
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1051"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78202"
FT                   /protein_id="CBY78202.1"
FT                   /translation="MLRRQFNPVGPNRVCCGDISFIRLQGKWYYLALVVDLYARRIIGS
FT                   ALSLTADADLVCRALRNALETRPRDRHLLFHSDQGCQYKRQ"
FT   CDS             69802..69921
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1061"
FT                   /product="hypothetical transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78203"
FT                   /protein_id="CBY78203.1"
FT                   /translation="MSRRGNCLDNSAMERVFRSLKSEWLPKGGYGDLAMRYAI"
FT   CDS             70279..70761
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1071"
FT                   /product="plasmid conjugative transfer endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78204"
FT                   /protein_id="CBY78204.1"
FT                   /translation="MLPASATPAIETGFSPEGSALQLVLKVVNTAQQNIRLMGYSFTSP
FT                   AVVRSLISAKRRGVDIQVVLDEKANVGKASVAAMDLLVNTGIPVRTANSFKALHDKVII
FT                   VDGKNTQVGSFNFSQAAVQSNSENVLIIWGDFTVVQAYLQHWQSRWNKGTDWRSSY"
FT   CDS             70851..71153
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1081"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78205"
FT                   /protein_id="CBY78205.1"
FT                   /translation="MYPLRNDPCLSFEGAEMSQIENAVTSSSKRAYRKGNPLTGAEKQR
FT                   MSVSRKKETHKAINVFIQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
FT   CDS             71462..72328
FT                   /transl_table=11
FT                   /locus_tag="Y11_p1091"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_p1091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY78206"
FT                   /protein_id="CBY78206.1"
FT                   /translation="MTDHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFT
FT                   SRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNLAIEC
FT                   GLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSALDV
FT                   SDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAHGLKR
FT                   ARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSRNNNYT
FT                   RLTTGAT"
XX
SQ   Sequence 72460 BP; 20388 A; 15809 C; 16065 G; 20198 T; 0 other;
     gaattctccc aatactgtcg cttgaatgta ctgatttagg ttatccacag ttaactgcaa        60
     gggaacttcc cataaagtta caaccgatat attttttaag cgccagccga agttgtttta       120
     aagtgcgtgg tttcttttaa accactgctc agtacttctt ttaaatacct tttcttttat       180
     tcctataaat aaataaccta ttcatagtct gccctttgga cagactatga taatgcccgc       240
     ccttgcagcg aactcacgtt cgcgccggtt cgaaaacaga aaaagcactg cccaccacaa       300
     tccgacgggc gcataagtcc ttattaatta caacattcat cattcaacca aaaagatgcc       360
     agaccgcaca catctgagac cactgcacgc ttgcccacta aaaagccgcc ccgccccggg       420
     ccaacggccc ggaacagagt ggctttacaa tgagtgttgt aactaaaatt ttcgagtcgc       480
     tgcaagtcat gtcgctggaa gtcattcgaa cacgctcgta agcggcccta atggcccgct       540
     aacgcggaga tacgccccgc ctgcggcaaa gccttgtcgg gaccactccg accgcgtaat       600
     gaaacaccta cgctactttt agtaggttta gctttgcagg gaggattttg ggattggtga       660
     aacctatcaa accggaaccg gctacgccgg gctatcggcg ccaattgtca acagagttat       720
     agttaatatc cgctggcgcc ttcatgccgc gatgcggcat tgaaaagacc ggctgcgcac       780
     tgctcgcctg tccggtaagg acatgatata aacgtttgtg tttaggggtt tggggagcaa       840
     cggaacccaa aaaccagtta actagccaat taacttaaaa tgaaaaaccg tcaatataga       900
     cggctgatat ccaacatttt tgcatgggta agcgaatact cggaaggtct gagtttgatt       960
     ctctgcttcg ccagattcat cgcctgcggg ctgccaccta agaaatctct gggattttgc      1020
     ccctttgtta tgccacaacc tttttggtag tgaaaattaa atgtttcagg aaaaactcca      1080
     gaataatact gattggaata ctgtgctaaa gctccatgtg atttcataaa attgacaatt      1140
     tcattgccaa tatgactgct gggagcagag catcgtaaat aactttgctt cccatctcca      1200
     ccaaaaacag tagctctaag agaactcatt cttatgccat taagttcaat ggagcgttta      1260
     atatcttgta agttctgttg taatccgaat gctgaatcga aatgtgcaca gagaagataa      1320
     tcgtgttgat ctgataaagc ataaagccct aggcaagttt gtatcgcagg cattgacaga      1380
     tctaacccat tttttttaaa gatgccgtat tgcccttgat atattacaac tctcatatga      1440
     ttaatatcct agttttattg gatttctttt gagctcagcc tcatgttaag tgtcaattat      1500
     ggtctaaaag tgagccacag ttatgcttta aaagtgcgcc actttaagac cggtttttga      1560
     acctaaatga ttcattgcct gtttcaataa tgtcacaatg atgaaccagt cgatccaata      1620
     aggctgctgt catcttttca tcggaaaata gttttaccca ttcagaaaat gctaaattag      1680
     ttgtgatcat aatgctggta tgttcatgca attgactgat taaatgaaat aataaagccc      1740
     ctcctttttg actaaagggc aaatacccca aatcatctaa aacaattaaa tccagctttg      1800
     tcagttgatt ggttaattta aattgtttac tttctttgtc caattccagc ttattgacca      1860
     aatctaatac attccagaag cgaactttaa acccattggt ggcagcgttt atccctaaag      1920
     ccgtggctaa atgcgtctta cctgtaccag gaccaccaac aaatataata ttacgttttt      1980
     ctctgatgta atcacagtca ttcagaagtt caatgctggg tttatttaat gggctttgtt      2040
     caaactcaaa gtcagacagt gttttatgct gtgggaacct ggcttgatta atacggtagc      2100
     caatactgcg gatatgtctt tgtgtttgct ctgtggttaa taaatttcca ataatatcca      2160
     tcgtagaacg cttacggcgt ataccatcaa taaccacgtc atcaaagttt tcagccatgg      2220
     ctgtaagctt taattgttta agtatttcaa tacattcatg ccgttccatt tggcacccct      2280
     tttaataacg tgttgtaacg ctgacaatta gcctggggcg ggatgttcag tggaatatca      2340
     tttattttaa acgtaggtat tacgggttca gtgagtcgat gaataatatt gagtactgct      2400
     tccaccgtag gcactccttc gtctaacgct atggctgccg cggtcacgcc taaatcttca      2460
     ccataatcag cgagtaaaga cagcaactgc accatcgctc tatcaccttt cggacgcttg      2520
     agtagatgtt gctggagttc tttaaccggt ttaggtaaat cccaattaat aaaaggttca      2580
     ccgtttctca gggcacccgg ttttcttttt aatgtggaca gataatgcca gggattatag      2640
     gttgtctggt ttttaataaa actgcgttga tgttgagcga cacactcgct atcgacaata      2700
     attttaattt ctgttgcggt cgtttttaat gtcactttct tacccgctaa attattggga      2760
     acgctgtatt tatgcccatc aaaacaggat aaggagttga tttggactat tgcaaattgc      2820
     cctcccgtat aaggggaata aggagccagc atagttcgct ctacacaaaa tagagtgtta      2880
     atgactttac ttctgtcttc tgggtgtgtg gctgtttgga tgatctgatg gcattgatcc      2940
     aatagaaagc tgtttaactc atcgatgttg ttaaaagcca gggtgggttc aaacagttgt      3000
     ttctgtaatg ttctcacttg acgctctacc tgtcctttct cccatccaga cgctggcgta      3060
     caggcaactg gctctataat aaaatgattc atcatgctta agaatttatc attaaaaatg      3120
     cgttctttac ccattcctat atgtttaaca gccgtcttca tattgtcata aatacctcta      3180
     ttgggtgtac caccaaaata agaaaaggcg tgattatgag catcaataag catatcgagt      3240
     ttctcgtttg gataagctcg aataaaaaat gctctgctgt gacataaacg aaaatgggca      3300
     actttaagtt taaccaataa cccatttaat ttgactgttt cgaaactcca atcaaattga      3360
     taggcatctg ctgcactgaa tcgttgggga ataaaaacaa cgtggggcgc gggttgatat      3420
     tgttctttga actgtctaat aaaagaggcg actgcacaat aagcgccttg atatccctcc      3480
     gttctgagcc tttcaaagtg acgtctggcc gttaatcgtt gtttggcggg taatttggtt      3540
     tcatcagtta ggcgttgttt taatactgga atgaactcac ccagtttggg gtagtgagtc      3600
     tgtgtccgtt tataagcggg cggttcttta gtctcgattg cgaggtattt actgacggta      3660
     tgacgagata tttgtaactg tttggctatg gctctctgag agagcccttg cttaagagaa      3720
     agccttctga ctttaagtat ggtttccatg cacagcatcc aaggagatct ccgtaaaaac      3780
     ggagagttta tcaataatca gggtggtgca cttttacacc ataattcccc gatcccttgg      3840
     tctacttttg cacaatattt aacagtctac aggctcgggg gctatccaaa tatctacaat      3900
     cactaaaaat cagtggctgg aagtgatata ttccggggcg ggtttaatca atgatagata      3960
     tcatcgtaaa tcagattaaa gagcttttgt gtgattaaca ccacctttac tgagctactc      4020
     caaaaaatag caagtcactt tggattagat aaattgagcc aagatgaata tggcttgtgt      4080
     gagcttatcc tcaacgaccg agtcgttatt atgctgaggg ctgatgaaat attgaatcga      4140
     ttgactctgt tggggccaat cttaggattt tctggaccag aggcgcgcag caccgctagt      4200
     cagctttttt tctgttatag catcaatgcc ttgaataagg acggcccttg tttcgcttgg      4260
     agtgaagaac tggggctgat cgcattcaag cacctttctc tcggcgagct gaatgttgag      4320
     aacgttagca aggagatagc gaacttttac gactggttga gcttggtcag tttaccagca      4380
     gaaactcagc aggaactgcc ccctcatact caatctactc aatctactca atctactcaa      4440
     tcggttaaat ggggatgagt aaagcatgaa aatcatggga actatgccac cgtcgatctc      4500
     cctcgccaaa gctcatgagc gcatcagcca acattggcaa aatcctgtcg gtgagctcaa      4560
     tatcggagga aaacggtata gaattatcga taatcaagtg ctgcgcttga acccccacag      4620
     tggtttttct ctctttcgag aaggggttgg taagatcttt tcggggaaga tgtttaactt      4680
     ttcaattgct cgtaacctta ctgagacact ccatgcagcc cagaaaacga cttcgcagga      4740
     gctaaggtct gatatcccca atgctctcag taatctcttt ggagccaagc cacagaccga      4800
     actgccgctg ggttggaaag ggaagccttt gtcaggagct ccggatcttg aagggatgcg      4860
     agtggctgaa accgataagt ttgccgaggg cgaaagccat attagtataa tagaaactaa      4920
     ggataatcag cggttggtgg ctaagattga acgctccatt gccgaggggc atttgttcgc      4980
     agaactggag gcttataaac acatctataa aaccgcgggc aaacatccta atcttgccaa      5040
     tgtccatggc atggctgtgg tgccatacgg taaccgtaag gaggaagcat tgctgatgga      5100
     tgaggtggat ggttggcgtt gttctgacac actaagaagc ctcgccgata gctggaagca      5160
     aggaaagatc aatagtgaag cctactgggg aacgatcaag tttattgccc atcggctatt      5220
     agatgtaacc aatcaccttg ccaaggcagg gatagtacat aacgatatca aacccggtaa      5280
     tgtggtattt gaccgcgcta gcggagagcc cgttgtcatt gatctaggat tacactctcg      5340
     ttcaggggaa caacctaagg ggtttacaga atccttcaaa gcgccggagc ttggagtagg      5400
     aaacctaggc gcatcagaaa agagcgatgt ttttctcgta gtttcaaccc ttctacatgg      5460
     tatcgaaggt tttgagaaag atccggagat aaagcctaat caaggactga gattcattac      5520
     ctcagaacca gcgcacgtaa tggatgagaa tggttaccca atccatcgac ctggtatagc      5580
     tggagtcgag acagcctata cacgcttcat cacagacatc cttggcgttt ccgctgactc      5640
     aagacctgat tccaacgaag ccagactcca cgagttcttg agcgacggaa ctattgacga      5700
     ggagtcggcc aagcagatcc taaaagatac tctaaccgga gaaatgagcc cattatctac      5760
     tgatgtaagg cggataacac ccaagaagct tcgggagctc tctgatttgc ttaggacgca      5820
     tttgagtagt gcagcaacta agcaattgga tatgggggtg gttttgtcgg atcttgatac      5880
     catgttggtg acactcgaca aggccgaacg cgagggggga gtagacaagg atcagttgaa      5940
     gagttttaac agtttgattc tgaagactta cagcgtgatt gaagactatg tcaaaggcag      6000
     agaaggggat accaagagtt ccagtgcgga agtatccccc tatcatcgca gtaactttat      6060
     gctatcgatc gtcgaacctt cactgcagag gatccaaaag catctggacc agacacactc      6120
     tttttctgat atcggttcac tagtgcgcgc acataagcac ctggaaacgc ttttagaggt      6180
     cttagtcacc ttgtcaccgc aagggcagcc cgtgtcctct gaaacctaca gcttcctgaa      6240
     tcgattagct gaggctaagg tcaccttgtc gcagcaattg gatactctcc agcagcagca      6300
     ggagagtgcg aaagcgcaac tatctattct gattaatcgt tcaggttctt gggccgatgt      6360
     tgctcgtcag tccctgcaga gttttgacag tacccggcct gtagtgaaat tcggcactga      6420
     gcagtatacc gcaattcacc gtcagatgat ggcggcccat gcagccatta cgctacagga      6480
     ggtatcggag tttactgatg atatgcgaaa ctttacagcg gactctattc cactactgat      6540
     tcgacttgga cgaagcagtt taatagatga gcatttggtt gaacagagag agaagttgcg      6600
     agagctgacg accatcgccg agcgactgaa ccggttggag cgggaatgga tgtgagtgac      6660
     aagtgccccc taagccttga gttgatatat ccgagaatag gctaagattt ggcaattgat      6720
     taacaataat tactttttat taaaaatgca taacacaaaa aatacgttat atatacaaat      6780
     gaaaatttcc agtattaatc tcaacaagtt tctctaccgg agaatattaa tctggaatgt      6840
     gtaatagaga aaatttatta tgctatcaaa tcttcatttt tcgcagaaat atccaatgta      6900
     taggtatgat aggagttaca tatcaggtta aaccgaaaaa tagttgtgtc ttttttcaaa      6960
     aagagtcaac gacttttaaa attgttattg atttttattt gagtccacag gagataaatt      7020
     atgcgtataa atggaacaaa ttaaaatagt taaatatcac cagtgactac ttactctagc      7080
     gcagtatatc gtaaaaagtt atcgtcgatt gatattaata ataagatcaa taaattagaa      7140
     agaatgaatg tccttgctgg acattgaatt atggactccc tgtaatttgc tcgggtgaat      7200
     tggctataaa cgaaggaaaa tttgttggaa taaataatta tagtacactt tatagaataa      7260
     tgaatctggg agttttggtt cgagtgctgc ctgtctgttc cgggttcacc catcaacgat      7320
     tgaacgtctt attgcaaggt accgtttatc cggaatataa aattcatacc gctgttaatt      7380
     ccctgaataa ggataaataa atgattgggc caatatcaca aataaacagc ttcggtggct      7440
     tatcagaaaa agagacccgt tctttaatca gtaatgaaga gcttaaaaat atcataatac      7500
     agttggaaac tgatatagcg gatggatcct ggttccataa aaattattca cgcctggata      7560
     tagaagtcat gcccgcatta gtaattcagg cgaacaataa atatccggaa atgaatctta      7620
     attttgttac atctccccag gacctttcga tagaaataaa aaatgtcata gaaaatggag      7680
     ttggatcttc ccgcttcata attaacatgg gggagggtgg aatacatttc agtgtaattg      7740
     attacaaaca tataaatggg aaaacatctc tgatattatt tgaaccagta aactttaata      7800
     gtatggggcc agcgatactg gcaataagta caaaaacggc cattgaacgt tatcaattac      7860
     ctgattgcca tttttccatg gtggaaatgg atattcagcg aagctcatct gaatgtggta      7920
     tttttagttt ggcactggca aaaaaacttt acaccgagag agatagcctg ttgaaaatac      7980
     atgaagataa tataaaaggt atattaagtg atagtgaaaa tcctttaccc cacaataagt      8040
     tggatccgta tctcccggta actttttaca aacatactca aggtaaaaaa cgtcttaatg      8100
     aatatttaaa tactaacccg cagggagttg gtactgttgt taacaaaaaa aatgaaacca      8160
     tctttaatag gtttgataac aataaatcca ttatagatgg aaaggaatta tcagtttcgg      8220
     tacataaaaa gagaatagct gaatataaaa cacttctcaa agtataatgt actttggaaa      8280
     tcttgctcca gtatgggaat acggttcagt tctttctggc tcatggtcac caacatagac      8340
     gcttcggatt gcctgcctgt gaagaaacag attaactggg gttctacgct ggaatcccag      8400
     atttttccgt caccccagtt tcagcgctgc cagagtacgg gtggtatgag ccgctagcag      8460
     aatctctatt ccaatggttg aaaaagaaag cgttaaaaat catagtacgg gcatttctcg      8520
     ggtttacgtt atttgtgcag aacgcacaaa taacgttatt ggatattatt gcttatgaac      8580
     gggtagtatt cagcgaaata cagctcctgg agcataccga cgtaatgcac ccgactcact      8640
     gcctgtcatt gttcttggac gattggctat agaccaggcg tactcaggaa aggggctcgg      8700
     gatagcatta ttaaaagatg caatatatcg aacagaaaac atagcccgag gaaacatccc      8760
     agtacacctt cataccagga tgcttatgac ttacaggata ttggcgatag acttcgctag      8820
     ctggtcttcc agaaccggct gggcttcttc aaatttcagg ttgaccttgt tagccgaaga      8880
     aaccacgcga gtctggtatt gatgtttgtt gcccgtctgt gtgctggtct gaactttata      8940
     gccagaggtg ccttgcttca gcgccgccac attgtcagtc tgtagggggg tgtccgtttt      9000
     ctcggaaatc tggacatccg taaccatagt ataattgatg tcctcgacca tcgcatccgc      9060
     gaccatccca acaagaccag ccgccaatcc aactcctaac gaggctcccg ctgagttaga      9120
     gttgtagcct gtaataccag cccctaatgc ggcccccagc gcagccccct gatacccctg      9180
     actcagaaat ccttcagctt cacgcaaatc cattttatcg gctttcagga cattagcctg      9240
     gatccagtaa tgtgcatctt ctggggacga tgtcacggta taccccttat cctgcacagc      9300
     ttttgtgatt ttgggggcta agccaagcat atttttatct gaggtatttt ttatctgtag      9360
     ataaacggtt ttctgtgaag acggctctaa ccaaatcgtt tcactcatct gcgttttcac      9420
     ttccagatta cgttttttga ttgctgtgct catcgcacca cagccggaga ggactaacac      9480
     tgaggacagt acggcagtta ttgctattaa cttcatgttt ttcttcatat catcttccat      9540
     ttaaaacagg gcatggcacc tcccatagcc acggttgacc aaaatgcgat ccagtactct      9600
     gataacggcg ctgtgttggc aggttcagat cgattacaat cgccagtgct tcacgattgt      9660
     aatcatccac ggtattataa agtactgaaa tgacccccac cgatcagtgc attgtgcata      9720
     aaatcgaccg acccgctcag gttaagtcgt tccggcaccg ccagctgtga tgggttacag      9780
     gctggcaggc gttgtttccc tttgcggcga atattgagtt tcaggaggca atagatatgg      9840
     tgtacccgtt tagcgatctc cttcattggc aaggtcagta tgccggaaga tctctaaatg      9900
     tgaatggtac gattatgcag gatggttaca taccactggt ttttatatgt tacagataat      9960
     taacctttaa cataatcaac tatcatatcc caaactcttt aatatagctt catcccataa     10020
     tacatttttg atcgcaggat tcgcgactca attcctccaa ctcagattta gagatgatca     10080
     gcataataca aaaacgatga aaattttcat catatagata tttttttatg tcatcattct     10140
     ctataagtag agagtttttc ggatcataca attctatatt ccctttactg tcttttttcc     10200
     ctgtgatcac ataccctata tcacaatcta atacagaaaa cacaagacca aaatcagaat     10260
     tattgggtag tttcttaaaa ttggtgtcaa tgtcgctgac atgttgccat tcgtataagc     10320
     gatatattat accaacagcc tgccataact cttctaaagt agataatatt gatccacttt     10380
     taagtggttc aatccctact ctattgacca atgaacaaac atccgttctc agtaaatgag     10440
     cagtagtaca gtagtaacta ttattttctt ctttagatgt atttattatt gtatcaggtg     10500
     ccgactgttc aagagcggta cataaagcac gcatgttata agcatcttta ataaacatag     10560
     tgactactcc aaaatttact ttataaacta cactatttaa taaccgtcac tacgagtgta     10620
     taattaaact cactccgtaa tttataaaaa tagaatatct actctcaatg agctccccat     10680
     gcatcggaat atttcaagta ttctccactc cgtgacgttg ctcattgttt atatgattat     10740
     ttattttaaa gctactgatg tagtataata tatcattatt agaatgaaat tttatcacat     10800
     tagagtttat tataaactct ccccgcgacg ctccgacgct atcaacataa catcactgtc     10860
     cccataagtt gaatttttat aataaaaagt aacttttaac tattgaaaaa atatttaatc     10920
     gaatgtacaa catgtactct gacgcagaga aaattcctga gtcacctatt ggttataatt     10980
     tattgcaggc tctatcgttc attgccagac gtcaaaatcc agctatattc agtttatcgg     11040
     tatagcaaaa taatggctaa cataaataga ttatacagat ggacagtatt cacggacact     11100
     accatatcca actatcgaat tattctgccg gtgaaaacct tcaatcagct acactcaccg     11160
     aaggggtgat tggcgcacac cgagtgaaag tggaaacagc actgtcacac tcaaaccggc     11220
     agaaaaagtt atcagctacc ataaaacata accagtcaag ccgttctatg ctggatagaa     11280
     agttgaccag cgacggcaaa gctaaccaac gaagcagctt taccttcagt atgattatgt     11340
     atcgcatgat acattttgta ctcagtactc gtgtgcccgc ggtgagagag tctgttgcaa     11400
     attacggagg taacatcaat ttcaagtttg ctcagaccaa aggggctttt cttcatcaaa     11460
     taataaaaca ttcagacacc gctagcggtg tctgtgaggc tttatgtgca cattggattt     11520
     ggagtcatgc acagggccaa agcttatttg accagctcta tgttggcggg cgtaaaggga     11580
     aattccagat cgatacactt tactcaatta aacagttgca aatagatggt tgtaaagcag     11640
     acgttgatca agatgaggta acactagatt ggttcaagaa aaagggcata tcagaacgta     11700
     tgattgaacg gcattgctta ctgcgtccag ttgatgttac tggtacgacg gaatcagaag     11760
     ggccggatca attattaaac gctatccttg atactcatgg gataggttac ggttataaaa     11820
     aaatatatct ctcaggccaa atgtcagccc acgccatagc ggcgtatgtc aacgaaaaga     11880
     gtggtgttac tttcttcgat cccaatttcg gtgaattcca cttttctgat aaggaaaagt     11940
     tccgcaaatg gtttactaac tcattctggg aaaattctat gtatcattat cctctggggg     12000
     tggggcagcg ttttagcgtg ttaacatttg actccaagga ggtttaatgc agacaacctt     12060
     cacagaactt atgcaacagc ttttcctgaa gcttggcttg aaccatcaag ttaatgaaaa     12120
     tgacgtttat acatttgaag tggatgggca catccaagta ctgattgctt gttatcatca     12180
     acaatgggta cagttgttca gtgagctagg tgctgatttg ccaaccaacg ataatttgtt     12240
     tggcgaacat tggcctgccc atgttcaagg aaggctggat ggtaaatcta ttctctggtc     12300
     tcaacaatca ctggtagggt tggatatcga tgaaatgcag gcttggttag aacgtttcat     12360
     tgatgatatt gagcagagaa aagaaccgca aaatactaag tttcagccca actcgacatc     12420
     acctatatta ttcatctgaa atgtaaacaa tcatatacgc ggtgccatac aaagttattt     12480
     cactacatag ttacaataat atctattaac tttaatagat atggtttata taataactca     12540
     tttgttttta attcactata aattaagaaa tttttattat ttatccaagt tttaacatat     12600
     agcatgacca aattagtttt atcaataatt attttttatt agtgatatag acaatttatt     12660
     gaaatatcct gccaagttaa atctccccca gttaataacc caccattaag tatttcagtg     12720
     atgcctccaa ttggttggat tttatatata atgctcactt ttaaactttt ctcataatcg     12780
     gcgttaatgt tcattgtccc cactatgggc ttgttgcaaa aaatggagtt gtcatgaaaa     12840
     ctgaaagaag gaaaatatac gggctgctgc aaagcagcgg caagtcaaat acctgaataa     12900
     tcgtatcgag tctgactatg ccccatcaag aaatgggtaa atgcggtcgg ggatttcaaa     12960
     cggccaaacc gtgcccggtc accgcttcag ggatttgaaa cattgctgtc cacttcccct     13020
     aaaatgagac agctataatt ggattttctg cctttacatt tgcagaggtc aaaatgaaaa     13080
     aagcacgttt tactgaaact cagattgtta acattctgaa gcttgctgat tcaggcatga     13140
     aagttgaaga aatctgtcgt cagaacggaa taagtaatgc gacctattat aattggaaat     13200
     ccaagtatgg aagctgatga tgttaaaaga ttaaaagaac ttgaagatga aaatgctcga     13260
     ctgaaaaaac tctttgctga agtcagtctg gaaaatcacg ccatgaagga gctttttgca     13320
     aaaaagggtt ggtagtaacc gagaaaaaat cctgcgccgg gctattaacg gcttcaggtc     13380
     tatcggttat tacggcttgt aaactgacct ctttatcacg cgcatctttt tgtcgtcgca     13440
     gggctgactg gcgggaaaaa gataaggcag tgatcgatgc tattcatgtc gttttgtctg     13500
     agtctcctca ggctggcttc tggaaatgct attaccggct cagatttaag ggttatatat     13560
     caaccataaa cgtgtttatc gtgtgtattg ccgattaggt ttaaacctta aacgcaaagt     13620
     caaaaaaacg ctgccaaaac gtgagaaaaa cccgttatct gttgtgaata aaccgaatat     13680
     tcagtgggcg atggattttg tgcatgatgc tctgtattgc ggcaaacgat tcagaacatt     13740
     gaatattatt gatgagggta cacgtgaatg cctggctatt gaagtcgata cttctttgcc     13800
     agcaaacaga gtgatccgcg tacttgaacg tctgaaagaa gaacgtggac agccccagca     13860
     aattagagtt gataatggtc cggaactgat atcggttaac ttactgaatt actgtgaata     13920
     taatggtatt actttgtgcc atattcaacc gggtaaaccc gcagcagaat ggattcattg     13980
     aacgttttaa tggttcattt cgccgggaat ttttggatgc ttatttatgt caggtcagag     14040
     aaatggtctg gttctggcag caggattata acctgaatcg tacccatgaa agtctggagc     14100
     atcttccccc ggagacatac cgaaaacagc tagaaaactc taatcaggtt tgtctcaaat     14160
     aacgggaagt gggcaatatt tgataagaat attgcgttta cttgaaaaac tttacagaaa     14220
     ccccccatat tttatggtgg tttagtttgt gtttatttta aaatatacat gacatatcga     14280
     cgttatgggg ggcattatgg aaataaacga tcttcaatca ttaataagca tgcaaattgc     14340
     agagtttggg ggaggggaaa aaatcggtcg cttaaaaagc actttacaac aagtttctac     14400
     tcaagctatt acttccgatg agcgcagatt tgcatacgca gtgcttgaac atgcaaaaaa     14460
     tacaatactc aatcgtcaag atgttgcgaa actattacca agggcgtcta attttgagtt     14520
     aagtcaagga aaaaaaggtg aagtgatatt aaaaggttta cgggttgaac aactgtcact     14580
     tgaggatgca aaattattgc tagatgcagt gacacggaaa tgcaaaagct ttaatatcac     14640
     aacttaatga taagttacct taaaacttaa aattcgatta tttcactgaa ttatatagta     14700
     cgatgaagaa tggttgctat atttataccg gcttacgttc gccatccgaa aatagttctt     14760
     agggtttagg gtggcgttgt aaacacaccg actttagtgc cattcacttt ttggggtctc     14820
     actttggtaa taacagaggg atcacctggt acaactttgt gtccgatcag tattccggct     14880
     ttcatggcat cgttataccg ggaacgctga gggactctat ctttgtgctg gaaggccttc     14940
     tggaacagga gaccgggctg aatccaaccg aaattatgac cgatacagca ggtgtcagcg     15000
     atcttgtctt tggccttttc tggctgctgg gataccagtt ttctccgcgc ctggctgatg     15060
     ccggtgcttc ggttttatag cgaatggacc atgatgccga ctatggcgtg ctgaatgata     15120
     ttgccagagg gcaatcagat ccccgaaaaa tagtccttca gtgggacgaa atgatccgga     15180
     ccgcaggctc cctgaagctg ggcaaagtac aggcttcagt gctggttcgt tcattgctga     15240
     aaagtgaacg ttcctccgga ctaactcagg caatcattga aatggggcgc atcaacaaaa     15300
     cgctgtatct gcttaattat attgatgatg aagattatcg ccggcgcatt ctgacccaac     15360
     ttaatcgggg agaaagccgc catgccgttg ccagagccat ctgtcacggt cagaaaggtg     15420
     agataagaaa gcgatatacc gacggtcagg aagatcagtt gggagcactg gggctggtca     15480
     ctaacgccgt cgtgttatgg aatactattg atatgcagcc agccctggat catctccggg     15540
     cgcagggtga aacactgaat gatgaagata ccgcacgcct ctccccgctt tgccacggac     15600
     atatcaatat gctcggccat tattccttca cgctggcaga actggtgacc aaaaggagat     15660
     ctgagaccat taaaagaggc gtcagaggca gaaaacgttg cttaacgtgg tttttttcgt     15720
     tccactgagc gtcagccccc tattcataca gccatttatc tgtgatttcc cgtacttcat     15780
     tcagcgttct gaacaggtaa aaatccagta tttctgttcg atatgtccga ttaaatctct     15840
     ctataaatgc attctgagtc ggtttccctg gtttgataaa ctcaagtttc actgcatggc     15900
     tctcagctca tttcgccagc gcaagcgaaa taaactccgg cccgttgtcc attcgcagca     15960
     tcaccgggta gccacggttg gccacaatgc gatccagtac tctgatgacg tgctgtgttg     16020
     gcaggttcag atcgatttca atcgccagcg tttcacgatt gtaatcatcc acacagatca     16080
     gtgcatcgtg cataaaatcg accgacctgc tcaggttaag tcgttccggc acccaacagc     16140
     ggtgatgggg tacgagctgg caggcgttgt ttccctttgc ggcgaatatt gattttcaga     16200
     agacaataga tacggtgtac ccgtttatgg ttccagacat atccccatca cctcaggatt     16260
     tgaaaaaact taaagaaacc gtcgcgtgga taacgctcga tcactgatct ggtgttcagt     16320
     gaatcagttt tttcgcatgg tgaacccctc aaaatacata ttcagtatgt cggaaactct     16380
     ctaaaagaga atggttattt ttgatgtcta ttacaataca gcttatttta tatcatttat     16440
     tacctgcttt tttttatatt ttttgagaga aggggggtaa taaataaaaa aaattataaa     16500
     gcaataaata tttgctgttt tttggtgttt ttttctatgt ttatgttttt ctttggtgaa     16560
     agtaaatgtg ttatcaggta atttcaaaag attacacaaa atatccggtt tgaggtgagg     16620
     catttttttt tatattatcc gtataacact tttcgtgtta tctgaaagta ttttgtagtg     16680
     ggctgactcc gacgattaga gattacaaac gacgcatata ctcagtagtt aatcgatata     16740
     tttttaagat cgattagtgc tgttttttgc atgattatca gaaaataagt catagataat     16800
     cctatccctc ttctatggga ggcgtccgct ttaattaata tatttctcag atgttataac     16860
     tgagctttta ttcacgggaa attaaagaaa tataaaaggt gcttacaatg actaaagatt     16920
     ttaagatcag tgtctctgcg gcattaatat ctgcgttgtt ctcatctcca tatgcatttg     16980
     ccgatgatta cgacggtatt cctaatttga cagcagttca aataagccca aatgctgatc     17040
     ctgctttggg tctggaatat ccagtaagac caccagtacc aggcgcaggc gggctcaatg     17100
     ctagcgctaa gggtatccat agcattgcga ttggtgctac tgctgaagca gcgaaaggag     17160
     cagcagttgc tgtgggcgct ggttcaattg caacaggcgt taattctgtt gcaattggtc     17220
     ctttaagtaa ggcattggga gattcggcag ttacttatgg ggcagctagt accgcccaga     17280
     aagatggagt agctatcggt gcgagagcat caacttcaga tactggtgtc gctgtcggtt     17340
     ttaactcgaa agctgatgca aaaaactctg ttgccattgg acactctagt cacgttgcgg     17400
     caaatcatgg ttattcaatt gcaattgggg atcgttctaa aactgaccga gaaaatagtg     17460
     tatccattgg tcatgaaagc cttaatcgcc aattgacaca tcttgcggct ggcactaaag     17520
     acactgatgc agtgaatgtc gcgcaattaa agaaagaaat tgaaaaaaca caggaaaata     17580
     caaataaaag atcagctgat ctgttagcaa acgctaatgc gtatgcagac aacaagtctt     17640
     ctagcgtgct agggatcgca aataactata ctgatagtaa aagtgctgaa acattggaaa     17700
     atgcgcgtaa agaggctttt gctcagtcta aagatgtttt gaatatggca aaagcacact     17760
     caaatagtgt tgctagaaca actttagaaa ctgctgaaga acatgcaaat agtgttgcca     17820
     gaacaacttt agaaactgct gaagaacatg caaatagtgt tgccagaaca actttagaaa     17880
     ctgctgaaga acatgcaaat aaaaaatcag ctgaggcgtt agcaagcgct aatgtgtatg     17940
     cagacagcaa gtcttctcac acactaaaaa ctgcaaatag ctataccgat gtgactgtaa     18000
     gtaattcgac taagaaagca atccgtgaat cgaatcaata cacagatcat aaattccgtc     18060
     aacttgacaa ccggttagat aaacttgaca cacgagttga caaaggttta gccagttcag     18120
     ccgctttaaa cagcttgttc cagccatatg gtgtggggaa agtaaacttt actgcaggtg     18180
     tcgggggata tcgctctagt caggcattag caattggttc tggctatcgt gtaaatgaga     18240
     atgtcgcact taaagccggt gtggcttatg ccggttcctc ggatgtcatg tacaatgcat     18300
     catttaatat cgaatggtaa tgtcatttag aaattaacaa gtctacagga aaacaccgat     18360
     tacgattatg taatcggtgt tttattcata tgctaatgaa aaatttttta gtaattctgc     18420
     tttttatcat ggtttcagtt acatggggaa ctacatggtt agcgatgaaa ttaaccgtcg     18480
     aaacaatccc tccgatattt gctacgggca tccgatttat gttggctgcg cctgtattaa     18540
     tcctaatatc agtattgacc aaaaccaggc ttttatttcc agatggacaa aagttctttc     18600
     aattatttgt ttgtattttt tatttttcaa ttcctttctc cttgatgata tatggtgaaa     18660
     cttatgttag cccagccttg gcatctatta ttttttctag tatgcctgtg tgtgttctat     18720
     ttttttcatg gctattgtta aatgagagag taggtattat tgcgatatta ggacttgtaa     18780
     cctcgacagt ttccttactt gcgatattat ttatagagac taatattggg agcaataatc     18840
     agtgggttgg tattatttcc ctcgtgattg ctgttattat gcatgcatta gtttatgttc     18900
     aatgtaaaaa aagaagctgt tctgtctctg tattgacatt taatgcaatt cctagtctcg     18960
     tcgctggtat attactttgc attgttggat ggattgctga acaacctgtt atatcaaagt     19020
     tctcacagca atcactgtta tcagtcattt atttaggtat tattgcgggg gtttttggta     19080
     ttctttgcta tttccagtta cagaataaag ctagtgcctt tcaggcttcg acggtttttt     19140
     tggtttttcc tattatcgct ttgctgttag acggatatgt gtatggaaga tatttctctc     19200
     tatattctat attattaatc atacctttgc taacaggtgt tcttttgatc tcattgagga     19260
     aatagagggg taataatctt attgatttat tatataacca agtggcgggt ttaaaacacc     19320
     gccacctgga gtgaatttta aaacgttatt aacctaaaat agtaacagtc ttgcttttgt     19380
     atgttcgttg agatatcttc atgattgata atttatgata aatggagggc taaatctcaa     19440
     agactctatc gtaatgacat cgaccactaa tcatatgcct gttattgtta aaatgcttaa     19500
     atataaaaca aaacttatga caatctggta tgttttcgaa tgttttgtca ttcatgctaa     19560
     tatagataaa atctagtgcc atccaattaa tatccgatac catccatagc gcataaactt     19620
     tttccattta tgctatacct tctattttca tcaattctgt tttctgtact taatgttttc     19680
     tttattttat tcgcagtgat ataaaattca tttttgtttt taaaacttaa cttctttaag     19740
     gctcttgttt ttatataact aattttttta cttggtaatc caagtatttt ggatatcagg     19800
     ctttgacttt taccatctat aaccatctgt aatattgata gttctaaagt atttaaattg     19860
     attgattccc atgatgctgc tgatcttgcc acattactgg ctatgctcgt cagtacggag     19920
     tcggtggcgg cacggttaaa cgatgcggta cataaattag taggcaccgc cgctgaaatg     19980
     gtgttatccg gcagccggta tgctgacgca cccgtgctgc ctggcgatgg aacacacatc     20040
     accttcccgt atgccggtga gtggttgacg gaggcggaga tcctggctgt gactgagggt     20100
     attcgccacg cggtccggga tgtgtgtacg caggtggtgg aagatgtgcg gcgtcgtata     20160
     gggggtccgc ttggaaaacg gaaaatatcc tacgctaagc ctgttttttg tacagactgc     20220
     tgtctactga gcgtaatgaa cggtatttcc cctgtcccag cttgaggttt gttcgccaga     20280
     cgtaatcccc actcaggttg atgtgttccc atcccagagg ggacagatga gaaatcaact     20340
     ggtcattgaa tgggatccct tttcgcttca gagaatctat ggctctttct atatataccg     20400
     tattccagag tgagatcgcc gcagtcagca acgtcagccc actggcccgg taactctggt     20460
     tttccagtcc ccgatctctg atttccccca gccggtgcat aaagactgcg cgcgcaaggg     20520
     cattgcgggc ctcaccttta ttcagccctg cctgtacgcg tcgacgcagg gaaggatccc     20580
     ggaaccagtc cagcataaac aatgacctct cgatgcgacc aatttccctc aacgcttttg     20640
     ccagaccatt ttgtttcgga taaaggtggc gaatacaggc tttttgtagc gcccggttga     20700
     agggggataa ttcaaggtag cgataaagtt cagccagatg ttcccagcgg gtgacttctc     20760
     ttgatgcata ctcggcccac aaatcaggct gaagtttcaa gtgagccgcc agccgggaaa     20820
     caaccccgtc gtgaggggag atatttttgt cgggtggaaa tcccggccct cgcaaatagc     20880
     agagtaatac agcaaagccc aggcggtttg cgggtctgcg gtgtttatta ataagcgcga     20940
     ggtcatgttc actcaaaaag cacatgcgcg taagaagaac gtcgtcgtcc ggcacaacca     21000
     acaaacgttc tttttcttca ctgctgagta tttgtctccg tggcatagat gcttcctctg     21060
     catatagttt atttgagtta tcgctttaca ctgaccgaaa ccgaccggtt tcgtacacta     21120
     tcctgtgaat gtgtccgaaa gtaagtgaaa tctatttcgt acagacgcta taattcgtac     21180
     atctatttcg tacagaaaat tacgccatgt cacgagtttt tgcttactgc cgggtctcca     21240
     ctctggagca gaccacagaa aaccagcgtc gtgaaattga agcggcgggt tttgctgtca     21300
     gaccccagcg gataatagag gaacatatca gtgggtcgat cgcggccagt gaaagaccgg     21360
     gattcatcag attgcttgac cgaatggaaa atggtgatgt gctgattgtc accaaacttg     21420
     atcggcttgg ccgtaatgcg atggatatta gaaaaaccgt cgaacaactg gctgtgtctg     21480
     aaattcgagt tcattgcctg gctctgggtg gcgtagatct gaccagcgcg gccgggaaaa     21540
     tgactatgca ggtgatttca gccgtggctg aatttgagcg ggatttgctg cttgaacgta     21600
     catactcagg tattgcacga gccagagcat caggaaaacg ttttggccgc ccttctgcgc     21660
     tgactgaagc tcaaaaacga gccgtgatgg aaagcctcaa tgcgggaagc agtgtcagtg     21720
     ctgttgcccg tgaattcaac actacccggc aaaccattct cagggtgaaa gcagcattca     21780
     gtccctgaga atggggtttc gctaattatt tgagtcgttt acctgactcg tgatcttttc     21840
     accatcctct ttcgtgaatg caccttgctg aggctccggt agtatatcca gtacgacctc     21900
     ggatggtctg cacagccggg ttccaagagg agtcacgacg atggggcggt taatcagaat     21960
     ggggtgttcg agcataaaac caatcagttg ctcatcgctg aatgtccctt cagcaagccc     22020
     taattcctca taaggctcca cgtttttacg cagcagagca cggacggtga tccccatatc     22080
     tgcaataagt ttaaccagtt catcgtgagt cgggggcgtt tcaaggtaat aaataacagt     22140
     gggctcattg ctactgttgc ggatcatctc cagcgtatta cgtgacgtgc cgcaggtcgg     22200
     gttgtgatag atggttatgt tgctcatatc agtatctcat tacaaagtga cagagagccg     22260
     cagtgccagc gcggccagag tgacaaacaa cacaggcagg gtcatgatga tacccgtgcg     22320
     gaagtaatat ccccagctga tggtcatgtt tttctgcgac aggacgtgca gccacaacag     22380
     ggtcgccaga ctgcctatcg gcgtgatttt ggggcctaaa tcgcaaccaa tcacgttggc     22440
     gtagatcatt gcttccttga tgacgccaga cgccgtgctt ccgtcaatcg acagtgctcc     22500
     aacaagaacg gttggcatat tgttcatgac cgatgacagg aatgcggtca ggaaaccagt     22560
     cccaaacgtt gccgccagca gccccttatc cgccagcata ttcagaaccc cggaaagata     22620
     ttccgttaag cccgcattgc gcaggccata gaccaccagg tacatcccca gtgagaaaac     22680
     aacgatctgc cacggcgcac cacgcagtac ttttccggta ttgatggcgt ggcctttttt     22740
     cgcgacagcg aacagcacca cagtgccgac ggccgcaata gcgctgacgg ggataccaag     22800
     tggttcaagc acaaagaatc cgacaagcaa cagaaccaga acaatccagc ctgctctgaa     22860
     ggttgcggga tctttaatcg cactggcagg cattttcaga agagagacgt cgtacgttgc     22920
     aggtatatcc cggcggaaaa acagatgcag catgcccaga gtggcggcga tggcagcaat     22980
     atcaacggga agcatgacgg aagcgtattc cgtgaagcca agccggaaga agtcagcaga     23040
     gacgatgttt accaggttcg atacgataag cggcaggctg gcagtatcgg caataaaccc     23100
     ggcggccatg acaaaggcca gcgttgtccg tttgctgaac cccagcgcaa gcagcatggc     23160
     gatgacgatg ggggtcagga taagcgcagc accgtcgtta gcaaagagcg ccgctactgc     23220
     tgcgcctaac aggacaatcc aggtaaacag cagacgacca cgcccgttcc cccaacgcga     23280
     aacatgcagc gcagcccatt cgaaaaaacc cgactcatcg agcagcaggc tgatgataat     23340
     caccgcgata aaggtcgcgg ttgcgttcca gacgatattc cagacaaccg gaatatcacc     23400
     cacatgaata acaccggata ccagggccag cgcagcacca atgctggcgc tccagccaat     23460
     actgagcccc cggggttgcc agataaccag gatcagtgtc agtacaaata tactccctgc     23520
     cagtaacatt tccgactcca ttacatatga ttaaaataat gtgttcgatt catctcagca     23580
     ggatgatgcc gctgatttat ccagccactg acgaacatct tcccgcaggc agtgccagga     23640
     tgtcgtgatg gtttctgctg cccatgcggg catatgagga gagagccggt aatggaccca     23700
     tttcccttcc cgacggtcca gtaccagctc agcctcccgc aggattgcca tatgccggga     23760
     aattttgggc tgcgactcgg aggtggcccc gcaaaggtca cacacgcaca tctcgcccga     23820
     ttccctgaga agcatcacga tagccagacg ggtttcgtct gacagaattt tgaaaagctg     23880
     aacaggctgt agcatttttt cttccggtaa acttagaata cacatatgat aaaccatatg     23940
     tgttgttttg aacattatcg cttttagaga ggaagaaaaa atggagcagt tcccagccct     24000
     gaatactgag tgtttcgaca ggcagatcgc tgagcggcta cagcatccga caccaccacg     24060
     tatcctgatt ctgtatgggt cagtacgtga acgttcatac agtcgttttg ctgccgagga     24120
     agcgggtcga ttgctcactg ctatgggtgc tgaggtcaaa acgtttaacc cgtccggttt     24180
     acctctgcct gatgatgcac cagaaactca ccctaaagtg acggagctgc gcgaactggt     24240
     gagatggtgt gacggcatgg tctggagttc cccggagcgt cacggggcga tgagtgcgat     24300
     aatgaaggct cagattgact ggatcccttt gtcagaaggc gcagttcgtc cttcccaggg     24360
     aaaaacgctg gcggtcatgc aggtctgtgg cggttctcag tccttcaatg ctgtgaatca     24420
     gatgcgtatt ctgggacgct ggatgcgcat gttcaccatc ccgaatcagt cctccgtggc     24480
     gaaagcctgg caggaatttg atgaaaacgg gcgcatgaag ccatcctcgt ggtatgaccg     24540
     aatcgtagat gtggcagagg agttgttcaa aatcactctg ctgctgaaag gtcatacgga     24600
     gtaccttgcc gatcgctaca gtgaacgcaa ggaaagccat caggagctgt cagcccgcgt     24660
     aaatcaggcc aaaatttagg gacaacgcga tgtcagctga cccagagcag ggagttacgg     24720
     gcatcgcact tcaatctgta taaaaaacat ccttagcgta ggatgttttc cgttttccaa     24780
     gcggacccct gtttggggct gaaggtggca gaaagaggat ggccactctg catctcttta     24840
     cgtgacattg tcacgcgcca aagagcatgt ccaggtctat acggacaacg ttgttaaatg     24900
     gtcgggtctt gccgcgcagt caaataccgg aaaaaccgcg catgagctgc tacatcagga     24960
     cagcgatcgg gaggttctga cggggaaccg gttgctggcc actgcatcgc ggtttgacaa     25020
     gacggctctg gggcggcgtg tcctgagcga aagcggtctg actggcgaaa gcctggctcg     25080
     ttttattggt gccgggaaaa agtacccgac accgtatgtg gcactgcctg tttggacaag     25140
     gcatgagcgt gaggcgggtg ccctgttgac tgagattcgt ctggaggatg atggggtacg     25200
     tgtcgtactg ggcgaagaaa cgtgtctgcg tggtgggaag atgcgcagtt tgctggtctg     25260
     caggcaagcc gtaacggcca gaccttggta gctgacagtg tccacttccc gttatttgag     25320
     acaaacctga ttagagtttt ctagctgttt tcggtatgtc tccgggggaa gatgctccag     25380
     actttcatgg gtacgattca ggttataatc ctgctgccag aaccagacca tttctctgac     25440
     ctgacataaa taagcatcca aaaattcccg gcgaaatgaa ccattaaaac gttcaatgaa     25500
     tccattctgc tgcgggttta cccggttgaa tatggcacaa agtaatacca ttatattcac     25560
     agtaattcag taagttaacc gatatcagtt ccggaccatt atcaactcta atttgctggg     25620
     gctgtccacg ttcttctttc agacgttcaa gtacgcggat cactctgttt gctggcaaag     25680
     aagtatcgac ttcaatagcc aggcattcac gtgtaccctc atcaataata ttcaatgttc     25740
     tgaatcgttt gccgcaatac agagcatcat gcacaaaatc catcgcccac tgaatattcg     25800
     gtttattcac aacagataac gggtttttct cacgttttgg cagcgttttt ttgactttgc     25860
     gtttaaggtt taaacctaat cggcaataca cacgataaac acgtttatgg ttgaatatat     25920
     aacccttaaa tctgagccgg taatagcatt tccagaagcc agcctgagga gactcagaca     25980
     aaacgacatg aatagcatcg atcactgcct tatctttttc ccgccagtca gccctgcgac     26040
     gactaaaaag atgcgcgtga taaagaggtc agtttacaag ccgtaataac cgatagacct     26100
     gaagccgtta atagcccggc gcaggatttt ttctcggtta ctaccaaccc ttttttgcaa     26160
     aaagctcctt catggcgtga ttttccagac tgacttcagc aaagagtttt ttcagtcgag     26220
     cattttcatc ttcaagttct tttaatcttt taacatcatc agcttccata cttggatttc     26280
     caattataat aggtcgcatt acttattccg ttctgacgac agatttcttc aactttcatg     26340
     cctgaatcag caagcttcag aatgttaaca atctgagttt cagtaaaacg tgcttttttc     26400
     attttgacct ctgcaaatgt aaaggcagaa aatccaatta tagctgtctc attttagggg     26460
     aagtggacac ctgcaaattt attgtgaacg gtcaccacga ccagatacgt catacttgtc     26520
     ggcatcacat taaatgaaag ccggtcatcg gtcataagaa tggtcaaaat tggcgcagat     26580
     tgcgctacgt aaaaaattta aaaccaatag ggggattacc ctgcagattt cacgtagcgc     26640
     aaccaaataa aacggcgatt ttttatccgt atgatctgat agctatgttg ggctaatcat     26700
     tcgaggagta ttgaatgtca ctcgtcacct atgaactggc cgctccctcc tcctcgtatt     26760
     ttgattttgc gcaggcggtg gccattcgcc ggatggcgct gaatctgtca gatcagccag     26820
     cctatcttct ggagtcggaa actaccttgc agttggaaaa tattcctgat ctgtgtaaat     26880
     gtatgctgtt tgatttttta tggaacacgg tacacgcatc aatgaagcct tagccgtgac     26940
     accgaaagat atcgtgatcg gccgtggtaa agccttttgt ggtgctgcac actttaaaga     27000
     agcgaaatca aacggccggt aaacgcggcc gcccaggaaa agattcgcca atgaaaagaa     27060
     tggtgctttt gctcgatgaa atgcctgtcg gaagacgtca gctttgccag cggtgtggcc     27120
     aactcgttgg cgatcgccag tttggccata atggtactgg cgtagcattc ttccgtcgca     27180
     gccggtaatg actgcctggg aatgtcgtag gtttctgatt gtgaaattag cgcaatgttt     27240
     tcgcctgtca gtgcggcgat aggtaaactg agttgctgtg ccagggtacg gatgcgttct     27300
     gcccactgac tgatagcccc ctttctgaat gcccggtagc gattcaggag aattggacca     27360
     gaaaccgggt aataagatcc gatccactcg ccttcaaatt caatatgtaa ttcattgtca     27420
     aacagtcccc aaagcaataa aacagagatc cgattcaacc tcatacgccg tgccttcggc     27480
     catgatgcgg gcaatcgata cccactttgc ggcgttcagg ctcttgggca aagcgacaga     27540
     actgctccta gttgcacata tcgcggatcc cctcggggga acatttgtca gccagtcttc     27600
     ctggcgagaa tgtgtctaga ttatccgtgg cgattcagtg gtagcacggt atcgagcaaa     27660
     aaccaaggac actcttagtt tgaagatgcg gataatatac agcttcagtt aacccatttt     27720
     actgactgat atttatcgtt ttttgtagct agacgagtgt tttcgattat gtacgtatag     27780
     gataaatttt tagtacctat atactggcat gccctgctgt taccgacgag caaaaagaaa     27840
     ggtcatctac agcagattag gtaactgtca aacttggggt atttcccata gtcgtcatat     27900
     agacggaaat gtgaacgtgc ccagttcggc attgaggctc ttacgcttca tcgcgatact     27960
     tggtcactgg ctgcggcgaa cgttgatatt ctatttatat atctttgcgt tatttttgtt     28020
     gttttgcgta ttttttgatg ttttactata aagacgcaaa tttcatagag ataatacata     28080
     tgaacctaaa gtcaactctt gaccgctgta ttgaacgtgg acagttcatg actcaagaaa     28140
     ttgctaaatc acaattcggt aatgacagtc cagctgctcg aacgattact cgacgctggc     28200
     gtattactga agctgctgaa cttgtcggag taacaccaca aacgatccgt aactatgaag     28260
     actcaggcaa actgccaccg cctgatacag caatgattgg tcgtgttgag caacgaactg     28320
     gatattccat ccagcaaatt aatgatatgc gtgatgtgtt taaaacaagg ctatccaaac     28380
     caaaaggcga aaatcctgtt gttcttgcca ttgcagctca taaaggtggt gcatacaaga     28440
     catcgacatc tgttcatatt gctcaatgga tggcgttaca agggttacgg gttttgttga     28500
     ttgatgcgac tgatcctcaa gctacggcct ctttatatca tggctatgtt cccgacctgc     28560
     atatacatga agaagacact ttgttgcctt attatcttgg tcaacgagat gatgctgctt     28620
     atgcgataaa accgacttgc tggccaaatc ttgaagtcat tccttcttgt ctggcagtgc     28680
     atcgtattga gtcggaaatt tatagcttgc atgatcaggg gaaattacct gtagcccctc     28740
     atcttttatt acgtgctgct attgagtcag tctgggatag ttatgatgtt gtggtgttag     28800
     atagtgcacc aaacttaggt attgggacta ttaatgtcgt gtgcgctgct gatgtcatcg     28860
     tagtgcctac tccggcggag ctttatgact atgtttccac gttgcaattt ttcaccatgc     28920
     ttagggattt gatgtcaaat attgatctca acggttttga acctgatgtg cgcgttttaa     28980
     ttactaaatt tagtaatgcg atcggtagtc agtctcagtg gatggacgat cagataagga     29040
     atgcatgggg tggaatggtg ttgaaagaag ttgttcgcgt gactgacgaa gtggggaaag     29100
     gccaagtacg aatgcgtact gtatttgaac aggcagctaa ccagcgttca acgccagctg     29160
     cgtggcgtaa cgctgtttct atttgggagc ctgtttgtgc agaaatattc aatcggctgg     29220
     ttaagcctcg ttgggagaat gcatgatgaa aaggtcagca gtgttacgta atgcgccttc     29280
     aattaatttt gatgatgcta aacccgcaat cagcaatgca gagccctcgg tttctgctcc     29340
     ggcggtgagt cagcttgctt ctcgagttag tggcatgaaa ggcaatacaa tcgtattacc     29400
     tgtttgtggg aggaacgttg cttttacgct taaagtgata gcagcacctg atgttgaatc     29460
     taaaaccatc gtttttagtg gtaatgagcg aaaccaagca ttattaagtg agacgtcgtt     29520
     agatgacttg atcccttcat ttttaacgtc agggcagcag atccccgcct ttgcacgtga     29580
     acataacggg aacatcgagg ttgctgatgg aagtcgccga cgtaaagccg cgatactcac     29640
     cggaagtgac tataaggttc tggttggtaa cttgaatgat gagcagatgc tatggctgtc     29700
     ccaagttgct aatgagtatc gtccgacgag tgcttatgaa cgaggcctgc gttacgccca     29760
     acggctaata tctgaatttg aaggtaatat tagtaagttg gcagaggcag agcatctctc     29820
     tcgcaaaatt attcagcgtt gtattaaaac ggctgagctg ccccttaaaa ctattcaact     29880
     gtttgctaac cctaatgaat taagtgctcg tagtggcgaa gcgttaaata aagcttatga     29940
     aaataacgtt gatgcgctaa agcgagttac gcataaaatt atgaagcaaa aacaggaagg     30000
     tcgccagttt actacggaag aattaatcgt attgctgatg cctgagagaa aacagccaga     30060
     gaacattcat aaaaaaagct ttggcaaaaa tatagaagca aaatattcaa aagacaatgt     30120
     ttctttctat ctcaaatctg cgccagagtc cttggttaaa caaatagaag aactcttgaa     30180
     tacctatgca aaggaacatt ctttgtagtg cctgaataag atcagaacaa ggtgggttgt     30240
     ctgcccgcct ttatttagtg tatatctatt attttagctc atccttcatt gaagatctcc     30300
     ttctttacaa ttcatttcct aagctgaact gtggtcccaa tcaccaacgt tggcattgga     30360
     tatccaggtg ggaccgtggt cccaattact aacgctggtt ttggatatcc aggtgggacc     30420
     gtggtcccaa ttaccaacgt tggcattgga tatccaagtg gaaatgtgat tcgaattgaa     30480
     agcgattaag tcgatgagca ttttttttag tgatagcttt agggagatta aactagcggc     30540
     gatttcatgt tagtatcgat gtaacaatga cggctctatt gcattaaggc acagtctggt     30600
     aacatgctgt tattttatga tattacctgc acatatcttt aatccaaaaa tttttttgtc     30660
     gcctgcatta ccccatcgat gttatagctc agtgtgttca ctggtatctt ggctatgccc     30720
     tgagttttct aaatccagag gaaatgatga cggaacacgg tatctctgtt gagcattcca     30780
     cactccacag ttgggttatt cgtgtggtgc cattactgca taaagcgttt tgtcgttata     30840
     aatgtaccgt gggtcgccgg tggcgaatgg atgaaacctc aaaggtcagt ggaaatacct     30900
     gtaccggacg gttgatactc gcggttagac tatcgatttt ctgctgacgg taaagcagga     30960
     tgcggcagca gcactgtgcc tactgttatc aggtctcccg gtaaattcat atattaaagt     31020
     aggcaagact ggctcattac agattgttta gctataattg tattactcag taatacataa     31080
     cggaggggat atggctcgcg taaccagcgt aacacttgga gagcatttga caggttttgt     31140
     gggggaaatg attcagtctg gtcgttatgg caatatatca gaagtgcttc gtgatgcctt     31200
     aaggctaatg gaagcacgtg aacagcgtgt tcaacatgta cgcgatatgg tgcttgcagg     31260
     aacaaacgca cctgtgagcc atcgcttaat ggatgaaatt ttttctgctg cggtgaaaga     31320
     tactagtgta taaactatct gaactggctg atgaggatat ttataatatt gccagttata     31380
     ctatccggca tttcggtgtg actcaggcta agttatacca tgagaacttg gcaaaggtat     31440
     tcgagctatt agctaaaaat ctagagttag gggctgagtg taactggatt tgctctgaca     31500
     tgcgccgttt tcagtataaa aagcacggta tatactatat aacgcttagc aatgatattt     31560
     tgatttctcg agtgctgcat caatccatag atatagatgc tcaggatttt ccagagtatg     31620
     agtagtaata cagaagagag ataagtcaga aattctaaca atgggcatgc taaaaaacga     31680
     ttcgcccctg aaatatcatg gacgaaaata ttcgcaatat tgatagaaaa agggggaaac     31740
     actaccccct tgtttttatc catatcacat caatgacagt aattgctgca tctgttgccc     31800
     cagccctttg atctcatttg ctgcctgcgt tagatcaacg ccactggcga cgtacgcgct     31860
     ggccgcccca ccaacagttc cccactgcga gaagggaata ccacaaacag gcgtgtttaa     31920
     aatggcactg gcctcagctt gcaattcccc accacaaaac tgcatcagcc cttggcattg     31980
     agtgatactg ccacgaagag ggccgctgcc cgtggcgaac tggtcatgat ttttctgcag     32040
     cgtctctgca tccaagctac tcaactgctg catgtatttt ggcagcgtct cagcagcaag     32100
     ttgcttgata ctatcactga aagacgtagg gcttggcatt tgtgcaggcg tgagtgctgg     32160
     tgtcaccacc ggtttatggc tcccctccga gaacatgcgt tggataaatc caatcacaga     32220
     gtgggccatt gatgataacc tctcaatgat acggctggct aagctggaac cctgagggct     32280
     ttcagtgcgc ccggccagat tgtttgcata ttgatcactt ttttgctgtg agactgagcg     32340
     cccagacatt tctcctacgc tgctagatcc tgacactgat gccggcaggg gcagtgatgt     32400
     agaaataaat gatgatattt tcatgactat ttattccctt ggctattaaa acaaggttat     32460
     cttagtggga aaatagccgg tggttatata aaaaaccgct actgtttttg tagttatatt     32520
     agacaaaata aaaactaaaa attataggct aaaattgatg gtctgccgag agtgctttgg     32580
     ttaagttgat attttatcta actattagga gatcaaatgt attcatttga acaagctatc     32640
     actcaattat ttcaacaact ttcgctgtct attccagata ctattgaacc ggttatcggt     32700
     gtcaaagttg gggaattcgc ctgccatata acagagcatc ctgtcgggca aatattaatg     32760
     tttaccctac cttctcttga caataataat gaaaaggaaa ccttacttag ccataatata     32820
     ttcagtcaag atatattaaa acccatctta tcctgggacg aggtcggggg gcacccagtg     32880
     ttatggaatc gacaaccatt gaacagcctg gataataact cgctatatac tcagcttgaa     32940
     atgctggtgc agggggctga acggctacaa acctcatcac taatctcacc accacggtca     33000
     tttagttgag tagatttttg cttgttgcct tattatacgg aaatagcgat aacctataaa     33060
     tttgtggtgc cagcaatatc agatttcgct cagtaaaagt taacaccaag ttggaatgtt     33120
     gacttttatc tcccgttttt taacaatttt taatgtaaaa gacttgtatt tttagtggca     33180
     tagtgaattt ggccacctga atagaggtga tatcataacc tcatagtcaa aacaggtgac     33240
     attataaccg gacgtaaccg acgcaatttt agccccgagt ttcgccttga ggctcgccca     33300
     gcttgtactc gagcagcatt acaccgttgc cgccgctgcc actgcgatga atgtcggcaa     33360
     atccacgatg aataaatggg ttcgacaact gaaagaagaa cgagcgggaa aatcacccat     33420
     agcttcaccc atgacacctg agcagattga gatacgtgag ttgaagaaaa gacttcaacg     33480
     cgttgaaatg gaaagggata tattaaaaaa ggctaccgcg ctcttgatgt cagactccct     33540
     gaacaatttt cattagttga gaaactcagg gcgcggtttc ctgttgccgt tgtgtgcaac     33600
     gtgtttgggg ttcatcgcag cagttataaa tactggtggc agcccaggaa gcctgacgcc     33660
     acgagagtgg cattactgag ccttgtgcgt gaagtttatc gcgaaagtaa cggttcagca     33720
     ggagcacgaa gcattgccgc aatggtccca ccaaagggat aaaactgagc cgctggcggg     33780
     caacaaagct gatgaaagcg ctcaatatta tcagctgtca gcaacctggc catcgttata     33840
     agaaggcgtc taaggaacac attgagatcc ctaattatct ggatcgccag tttgctgtta     33900
     ccgagcctaa tcaggcctgg tgcggtgatg tgacttatat ctggacggga aaacgctggg     33960
     cttatctggc tgttgtactc gatttgtttt cccgtaaacc ggttggctgg gcgatgtcat     34020
     ttttccctga ttccgcactg acaggtaaag ccctgtcgat ggcctgggaa gcacggggaa     34080
     aaccggctaa tttactgtat cactcggatc aaggcagtca ctataccagc aggaatttca     34140
     gacagttact gtggagatat cagataaagc aaagcctgag tcgccgggga aattgctggg     34200
     ataacagccc aatggaacgg ttcttcagaa gcctgaaaac agagtgggta ccggataatg     34260
     gctacgcgaa ttttagcgaa gccagcacgg cataacgaat tacatcacag gatattacag     34320
     ccagctcaga cctcagtcaa tataatggtg gtttgacgcc gaatgaatca gaacgattgt     34380
     tctggaaaaa ctctaaagct gtgaccagtt tttgttgacc actacaatta agcccattca     34440
     cttggtggag tcgccgcctc ctcattggta atgaggagta ccggaagagt tctcaatgtg     34500
     aatggttgag ctgtataagt ttgttatact ttatatccac ggtgatacaa cgttggggta     34560
     gcatctggga aggagagaaa taaaaaattc tatatttttc taattttaaa gggtcagtta     34620
     tatgcgcact tacagttcat tacttgaaga atttgctaca gagctaggtc ttgaagaaat     34680
     agaaacaaat gagttggggc atggggctgt taccattgat aaaatatggg tagtacatct     34740
     ggcacctatc aatgagaagg agttagtggc ttttatgcgg gcagggatct tgactggtca     34800
     gtctcaactt tatgatattt tgcggaaaaa cctctttagc ccactctctg gtgtaattcg     34860
     ttgtgcgctt gataaagatg atcactggct attgtggagt cagttaaaca ttaatgacac     34920
     cagtggggcg aaactggcga gcgtattgac gtcgctggtt gataaagctg ttactctttc     34980
     ttgtgaaccc acaatgaaga aagaggacga tgatcatcgt ccttcatcat ctcatttact     35040
     ggtttaattc tataaaagaa aaacgtacgg tatccattaa tgggtttggt tatataaagt     35100
     aaaagtagac acataacttt taattttgtt gtttatattt ttgttaataa ttattctaca     35160
     gcagataaac ctcaactaat tgcttacttt agttgaggtt taaagtttct ttgattggca     35220
     aagtggcgta tatatcttag taattttatt tactcatagg aataaatatt tacattagct     35280
     atttaataat ggtcgccctt gtccttcagc caacttaatc agaacatcaa gttgctcatc     35340
     tttttgtacc ataataccat ttctttgtac tcgcatttgg ctgaccatat cttctacgct     35400
     taactgacta ttacgactat cattcatgca cattgcgcca atcagttgcg cagtacggcc     35460
     aacacccgca cggcaatgta ttaccggccg taatttggag tcatctgcta ccgctgaact     35520
     tcctttgctt tcatacatat tgcgttttgt ttctgctgtt tgatctacca gtgaagcgag     35580
     tgccttggta acttcagagc tgactgcggt ctgatcgggc caattgccaa catgaaccac     35640
     aggaacagaa attgtttttt gacccgcttc acgaatcgtt aaagtataca tatctgccat     35700
     aatcccgtca ccgagaccaa cttgctgagt cattttagac tctacagtga tactgccata     35760
     ggtaccactc tggcggaaat aatctggcat accgaatctt tgagtggcta tctcagaact     35820
     ggacgctaaa acagccaaca ctggcgttcg gttttctgcc agcatacgga aatggctttc     35880
     aagttgagat tgtagcggat actggcacgc tatggtacga gtgttaccga cctggatgta     35940
     attggcatta agatcggcgc gtactgcggt ttgccgacag cattgaatat ctctaaatcg     36000
     gtttagcttt tcaccgccgc aggcttgtaa gtaacgcgga tcattcgttg ctggcgccag     36060
     cgtattgcgc aatgtggtga ggcggctgct gagttctgcg cgcgcttctg ggccataagg     36120
     agaaacagtg cttggtgcgg tggctctggc ttcgccagcc ccgtgatggc cagaagtatg     36180
     tggtcgttca cgcggtggca acggtggagt tctggagtct agatgtgaac gcagtccttc     36240
     acgcaccggg gttcccggtg cgtgaaggac tgaatgtgaa tgagatgata catgccccct     36300
     cgctcccgac tcttgtcgca atgcagcctc caacagcact ttggcgtctt gtagtgtcat     36360
     ttggtcacta cgtaaactga caagtacact attaccattg ccgacacttc ttaattcata     36420
     attattcaaa ttatgcttta ccgtgctttg caatagctta gcggtatctt cttgagttag     36480
     aacaatattt gctacgtggc ttagtacagt ttgagcaaat actttttctg actctctggc     36540
     accactggct atggtcaaac cttgaaaggt agtttcttta ttggcagcaa cgttacctct     36600
     taatttcccg gtacaatcac cgctctcttg ctgcaccaat cgagatacct gacgatgaag     36660
     atcgcttaat gataagttca tgcttccctc cttaattaaa ttaagaacta attaaataca     36720
     cgcctatact ataaacataa aaaatatttt ttcttataat gctagtcgta ttattttaat     36780
     aataggtgag ccgtgtattt tcattgatgt taatcgaatt attatagtgt tcgttagttt     36840
     tttggctttt cccataagat atatactcat tgttacctta aattttttaa aaaattaagc     36900
     gggaacagat ggcaatacgt taataattcg tcattcattt taatacgcaa atgtaattta     36960
     aactcatcat catttagata aatatatttt taattccaat gccctgccgg catggcgtaa     37020
     aaatataaag tatccatccc cccctatttt tttggcaata atgtcagcca gcccactggt     37080
     gatgcaggaa taccagagat agcaacgaat attgcctggg atgacatcaa aataaccata     37140
     acccggcagt cgctacaatg tgatctttca tcctaattct ctcaatttat atgaggagca     37200
     gactctactg ataaataccc ccacttcagg ggatcaccga aggaggcgta ttattattct     37260
     aaattggctc aagggaaaga attgatacat gacttcttga aaaatagtta cgtaaatcaa     37320
     cctgggggta ttatcgcctc aatatacagt agatatatat tatcgtcagc cgtcagccgc     37380
     cgtatcctgg cgcatggcgg cttccagcaa taacttagca tcactaagcg agagttgttc     37440
     agtacgcaag ccggtcacta tcacttcccc tgccttgccc tgctttagtt ccaaattaga     37500
     aacgcgtggt aataagcagg caatatcgtg acgactgaga gccgtatttt tcacatgttc     37560
     cagtacctca ctggcaaagg ctttttcggc ggtagatatc tgatggctat tctctgtgag     37620
     tgggttagtt tccgtgagac gaccggcctg ccccccgtgt cccacttggg taatttgttg     37680
     atttattaac gattgaagag tattgatttt catcgagtct cctgtcgcta taattatctc     37740
     tacgatattc taagttattt atttttgcta aaccactgtc gtagacgatt tattttttta     37800
     atcggctttt aaacgaaaaa tcacaataaa aaattattct ggggaatcgt tctcataaaa     37860
     cgaggatgaa acatccaatt tatgtagata attcaatctt ataatagata acactaaaaa     37920
     tatatcgata gttattcctc ttctgtaact ttcatttgtc ctaaagtggt agatattgcc     37980
     cgagaaagtg cttcaatttg cccatcaata ctcgcgtcaa taatacctac ctcagtctct     38040
     aatatacagc ccccttgatc caaacgcgca tcggcagtca cctctaaata gcttatttcc     38100
     gggaagtctt tatgtacttt agctatttgt tcacgaatag ttccggcctg atcagggttg     38160
     accctgacca cgacttgctt ctgattactc accaaggcta aagcctcccg cacaacttgc     38220
     agtgtcatat ccacttgatc atagtcattg aggattttac gtaccgccaa aagtacaact     38280
     tcactcatct gttgttcgac gtggcgataa aattgctgac attgtaactg tgtttcatga     38340
     atcaaagtcg cctgtaaggt acgcgcctca tccatgcccg cctgccatcc taactgcttt     38400
     tgttgctcat aaacctcttg ggcgtcagcc aaaatctttt cagcatcctg ttttgcggca     38460
     ctaatcaact cttcggtagt taaactggat tggtaatctt cggcgcgcaa aatacgcaga     38520
     ccgcaagcga gcgagagatt acttggtatt atttgaacaa atggctgcat gtaggcatca     38580
     cctgtttgac aagtttgtga cataaagttt gggccagtgg gcgttgtgac tcggccacta     38640
     accaaggttc tgacggcgta gctaatggga ggcgtaaact gagccgttta caccatgcct     38700
     gaggttgggg ttccattgct gctaaccaaa aagccagccc cgactggatc atggtacggc     38760
     tctctatttc tgtcggcagc gggcgctgcc agttagtggg ccaaggcccg attagcagct     38820
     catgctgtac aataatttgc cttaatgttt cttgattaac caatgtcaat aattgttgta     38880
     atggggaggc cagtacacaa cggcgaatcg cctccccatg cagaactaat ccaaggcgac     38940
     aaagtaacag ttcgagctgt gattggggct gcaaaggcag cgcccccaac ccatggggct     39000
     cttcatagtc ggtatcaaga gaaaattcat ccaataaagc agcattgaga tgagcactat     39060
     cgcgccactg aggtaagtag ggcaatattg aacgccataa tgatggtaac tgttccaagt     39120
     gcaaataagc cgcggggcag aagcgcaatt gaaaagaggt aatataattt tccatcatca     39180
     cttcttgcgt tgtaaccaaa aatattgagc aagattggtc actggcaaaa gcaaaataag     39240
     caacgacaac aagccaataa gacgcccttt tgactcttca ctcacttgaa ttgacagtat     39300
     gctcgtgtta cgaggtaaat gagagctttg acgaacatct accgatggca ccaaaatgac     39360
     actgatgcga tcataggcca gcccctcaat actattattc actaattgtt taatctgagg     39420
     tatgtaggtg tcaaactgaa tatctgctgc gtgcttgata aaaaccgaag cggatgctgc     39480
     tacgcccttc ttacctttgt tattttgctc ttcaggcaat acgacatgca ctcgagccac     39540
     taataccccg tcaatttcag ataaagtgcg ggagatctct tgcgccttgg cataattaag     39600
     cctcgccaac tcttctatag gtgaagatat caacccatct ttggggaaca catcctgtaa     39660
     cgtggagaaa ctctcgtgtg gatagccctt ccgtttgaga atatcaatag cctgagcgac     39720
     atctgactcc tcaaccaaga gcttaatctt cccatctttg tctggctctt tgtctgcgga     39780
     aaggccttct tggcgcaaca gcgcgagcat ttcgttccct tccttctgac taattccggt     39840
     ataaagatca actttgcaac cagttaaaaa caagattaat atcaatgttg acagtgaagt     39900
     cttaactttc actagttctc accccccctt cgacaaggtt tcaacatttt ggctcattcg     39960
     cccggcagtc ttggcgataa gttcttcttg gattgttata cggataagtg accattgcat     40020
     tagcatcagg tcgttgggat tatcaactga aacagccagc ttagtgtgca agtcactttt     40080
     agccgtctta aaagtcttct gaatatcact aacctccttg aggagtgaat ggcccagtcc     40140
     ctgcgtatct tctgacattg ccgcatcaaa gcgcattatt tgctcagttg ttggctctac     40200
     cggcccgaat tcctccagcg tggttatgat cacctcatcg gcctgagcta tttctatgtt     40260
     cgacatttat gtatccatat caatttgatg gctgttatga agtaggctat ctacaatcga     40320
     gttatacggt aataggatca ttaattcttt atttattaac tctgataaat aaggtaatcc     40380
     aacctggctc tcattgggtt ttataccctc taatacttgg agcaaaattg cttccctccg     40440
     cttaccaaac gagtcaaact gctgcaatac actacgcaat tcaggtaaat ctatagccgg     40500
     tacaacaggc ccttgatgtt gaccgaaacg cgccagtaac gcctcacgta cgggcgtcgc     40560
     caaaacctca agaacggcat ggtcaggagg gttactggca taatattgct gccacagaac     40620
     ttcccgtgtc ttttcagcgg attcactttt tagcttatgc tccagttgtg ttttcagctc     40680
     agatgctgcc ggttgtagcg tagagactgc ctgagacgaa gacatcaacg atgtaatgga     40740
     acctctatta agggtaaccg tcatgttttt agttgctccc tcattccatt cacaaatgtc     40800
     tgtattctag ggtcctgact cgttgcgaga cgatttaaac gtgactctaa ggcgttcccc     40860
     aacccgaggc gatattcaca taaggctaac caaggttcca aatcaggata agctgattta     40920
     tttccttgtt gcaaggcgct tgcgtagtcc ccacggttca tcaaagagga aagctgaatc     40980
     aattgaaccg cctcttcttc acctttcaaa tgtaaccatt cagcaatgca attcgcttct     41040
     tcgtggcagt ggttgccggt tccaatcaga gcaatctctg ctaacagtac gttgagttta     41100
     tatttcatat tatgggaact tctgtaggat gccttgcatt aagtctttca tgctacgaac     41160
     tatggttgag ctcatattgt aaattaccga ccatttatta attgaatgtt gtaagtcagc     41220
     aagtagcgcc gggttgtcag gcgtatcttt caacgctgct atcgagtcat taaccgcttt     41280
     gtttgcgtcg tctgctggct tcttgagcgt ttgagccacc gcatctaagt ctgtgatatc     41340
     ggttcctttt gcaaacccag ggaaattact cattttttta ggtctcctgt tacataatga     41400
     ataatggcta tagctgactc aatagcttta gattcactct gccaaacctg atactgcttg     41460
     gcatcaccac cgcgcatcat atcttttttg agcttcgcta gcgccatttc tagttgcatg     41520
     gtgatagagc gcactgtctc cacgttatgc agttgctcct ctaattgtgt catcgaggtt     41580
     tacctccatt gagctggatc acaaattccc gttttccttt actcacaatc accgcatcgc     41640
     gtcgaatagc cagaatacga acgccattgt taagtatggc gccttctgga tagcgttgat     41700
     gattgtcgag taccacatag ggcactttcc ctaacgagat agcttgcacc tcaaaattca     41760
     attcatcatg ctggggttgc cccccgacat tgaccagttc taatttaggt cgattgccaa     41820
     actcttggcg aaaagtttgt tgtagttgat taaatgaact caatttttca tcattgactt     41880
     gcccgcgtaa ttcaatcagc tcacctttaa catttaccgt gaaatctgaa tccagaccaa     41940
     attgttcaag taatgcatca agccgcttgc gttgattacc ggcaatccgc actttatttt     42000
     ctacaccaag cagccctggc acttcagctt gcagcaggct atcaattttt tgcttttgta     42060
     tttcctctga cacttcccca ttcaattgta gccatcccgc ttgcggtgct aaagaaacct     42120
     caattccatg gtatcccaac cgttgcagaa tgaattctgc cccctgacgc agttcttcca     42180
     tgctgcgcag ttcaagccgg aatggaatgc catggctctc aagaaaattt tgcagtgaca     42240
     agcgggcatg attatcctgg atataaccag ttaataacca aggttcaccc tctttgggcg     42300
     atgttaaaac gacatccttg taggcagcag ttgccagcaa gcgccgtact tcttgctcaa     42360
     caagttgtcc atcctggtta tactcgcgcc acaatccgtg ccctagcatc cccaaaaaag     42420
     tcaaaagcaa caataaagaa agaactccaa gcccaacccc aagtcgtgaa cgaggtaacc     42480
     tgtcggttgg ctcttttctc tgcgtgggaa cctgtaacgt ctctggcaaa ggttgcccta     42540
     cggcgacaaa tgtccacagt aaaaacccta cttccagaca agtgcccgcg cgaagaagag     42600
     tccccaacgg cacgggaagc ccttcttgta gtagaggttc tgcagaatca gttaggcgaa     42660
     taccttcttc atcgaccatc agcactaaat gcacgggtgc tatttcgctg tcagaaagaa     42720
     caatatctga ttgcaacggg tctgagccaa aaacacagcg cccatgagga agctcaactt     42780
     caacaccacg gtgcttccct tgataaaaac gacagaccca actcacaata cgccacgctt     42840
     aggtgctgaa acacaccatg attgcgcggg agtacaagca ccttcaacca cgcgccatcc     42900
     caaacttttg tccatcttgc actgagtaag ataggatgat ttattatttt gactcagcca     42960
     tttctgcact tcttgcgctt tgtttaaagg ctgacactgg gagccaccta ataacttatt     43020
     caaggtagtg ctttgattag atatttcatc aacagttaag ataccagtac gtagatcctg     43080
     accattacct aacgctaaat gatgcgcaat accttcgtca ataatccgtg gttcgatgat     43140
     aaatagccgt accgtacggc gagttaactc acttttacgg cggaaaagtg cgccaatata     43200
     aggaatatca ccaagcaaag gcaccttact aagagcaaca ctcaattcgt cacgataaat     43260
     accaccaata atcaaactct ggccatgtcc cacgcgagcg acagtatcaa cgaccgtacg     43320
     actgatagtg gggattcctt caatccctga actattcggt ttttggttcc catcctcaat     43380
     gtgtagattg agactgattt ctgacttatc tccttgagtc agcacccttg gcgtcatacg     43440
     cagcatagtg ccgtaggtga tccctttcag ttcagccact tctttacctg tcactttgac     43500
     gtaataggtt tcactgtgat caatcaccgc ttgggcattt tcttgtgtta acagggtcgg     43560
     acgtgaaaca acttgagccg aaccttcatt ttcaagtaaa ttgactcttg ctaataggta     43620
     gtcaagcccg cgagcatcaa ccaaactacc caatgcaccg tttgaagcga tgttactttg     43680
     atccccggtt gtttttatta ccacctgatg attgttgcca gtacgaatgc caactcgcca     43740
     gtccacacct aattcagtaa gttggtcggc atttatatcg acaatggata acgccacttc     43800
     aatacgagcg ctaggcttat caagcgcatg aattaaccgt tgatacattg gcatacgctc     43860
     aggagaatcg cgcactatta tcgcattgag cgatggatcc gcttcaactc tggcttgagc     43920
     tgaagcccgg gttgcggcct gcggtattct ctgattatcc actgtcactt gttggatagt     43980
     ggcatcgctt aacacgcgtt gaagtatcgt tgcaacccca ggagcagcca cttcgtcatc     44040
     acggtaatga atagttcgat cgctcgctga tgcatatttg agagggaaaa tctcaatcgc     44100
     taatgcccct gttttttcac tgcgaatttg cgtctgttgt tccaatgcgg ctgcggtctg     44160
     ttcaaccaat tcaagataac gaggaggacc agagacgtaa accaggcggt tgctagcatc     44220
     agggcgccag ccaaaacgag gctcccatat accagaacgt tgtaatgcct gctttaactc     44280
     tgcggcctca ctttcctgta aacgaatgag acgagacgct acctcactat ttttaaaaat     44340
     gtagagcaca ttgccatcat agtaccaaac caaattgtaa agagaggcaa tatgctgtag     44400
     gaaatcctga gggttatcat gctcaaactg gccggaaact ttgtcattaa tcttatcgct     44460
     tactaccact gtagcatcat aattagcgcc gaaatcagtt aataaatcgc gtaaactttc     44520
     ccccttcgcc acataaacat aaggtatagg caaccaatca agttcttgcg cccagctata     44580
     gctagaaagt aacagtaacg tcccggtgag tacgcgcttg aaaaaagaat gtagcggaaa     44640
     agccatatta cttaattcca ccccacgcga gacgctacag aaaatggcgt taactgagga     44700
     attaaatgtt ctagcagagc cagttgttta tttattactt cttgcaatcc gtgagtatca     44760
     agctcttgta gacgtaaacg cgcctccagc accaattgac cacaatcatc caatactaaa     44820
     gtttgaggat aacgtttagc ccatgccaac gcttgttgca ttagggagcg aagcaatgtg     44880
     acgttaacgt tatttccttc acgtaacatt ggtgcgtcaa taggagtgcg taataccagt     44940
     tctgaaccat gcggagtcag catgacaaga tgcttatcta tagttaaacg gtaaacacct     45000
     tgtttatcgg caacaaacgg ttttcttcct aaactggtag ccaagttttt tagtaaattt     45060
     tgcattattt ctcagatggt tatatgtaaa ctaagtaatc ctgcgccaaa taaataacct     45120
     acttcatgtc atcgtgacat aaggtttcgc ggttcagctc aaacttccag atattcaaaa     45180
     aaatgttcgt gataattatc aaccacctat atagcaatag atgatattac gttaatcgaa     45240
     ctaatgagac ttgctctatt tgatggcgct cgtttcttgc gccaccgcac ttaataagcc     45300
     agataagcta tcttgattat taaacaacat attattgcca tccagcggcg aaataatact     45360
     gttatatgtt tcgttgtaat ttggctcatc ccattgaatc ttcaaaatct aaccccgtat     45420
     tttactttat agtccaaaag tgttttaaaa aaaaaaaaca gataatttta gcctgtggtt     45480
     gctattttag taagacgggc ttggctggga gtgcatccga agcgacgtcg ataactttga     45540
     gtgaaataag actgactcga gaaccctgct tccatggcaa tatcaacaat actcatctta     45600
     ccattaagaa gtaattggtg agcatagaga atacgtcgct cgcttatcca ggcgcgtggt     45660
     gaaatgccat aaactgtacc aaacagttct ttgaatgtgg ttaatcccat gccgaattct     45720
     cgcgcaaatt tgcttagttt ccacccttgt agataatttt cctccataaa tttctgcaac     45780
     cgttcttctg ggcggttgcc taaatggcgc agagccgaga ggaataaagt cccttgcgag     45840
     ctaaaggcaa gcaaaagcag taattcctca atacgcagtt gcgttaatac tgacggaaaa     45900
     tcactccgtt ccaatatggc acatagattt tgaatggatt gtgataatat tggtgaaata     45960
     ttaaaaatta acaatggctt gggtgtggca ttgtctcgtc taatttcact aagcaaagaa     46020
     ccaaaccgat gtaaaaaagt actcaaaaaa ctgcctggta atggaatcca aagtaattgg     46080
     cagggttctt ttgtaccaca tcgaacagca tagctgccac gacgcaaaaa cagcatattc     46140
     ccctcatcta aatcatatgt ctgactgctg ttctgccatg aaatctgacc ttgcaaaaga     46200
     atatataggc catcttgtga atgctcaaca accttaaata taggtgtggc ccattctaat     46260
     ttaataatct ctagtgatgc cataaatgtt atactgtcct aaaaatctaa aacttgtata     46320
     tatttatcta atgaggtgta ttgagttatt atgcgtgcga tgtacaacca tcgattaatg     46380
     caaccaaaac caatataata aatcacctat ctggtattag gtgactggca atttggataa     46440
     catgttttag gtatcatttg taaaacgact ttgtttttac caataagttt ttgctgagcc     46500
     accgcctgaa cccctcgctc tggaaaagag agggttgacc gtaggtaaag ttcaccttcc     46560
     ccgcgttgag ctggattcag ttttatagaa aagaataaag gtaggttacc tgtttcgaaa     46620
     cgagtgcgct gaacctctcg aactttcccc tcatacaacc caaatatact aacatcaatg     46680
     tgtgctgtgc gagataatgg tcgtgacata cgcacctccc ccacaatacg ctgagctggc     46740
     attggggggg tagcgcaccc cactaataga aaagaaatga taagtgctat aatacgactc     46800
     atgccagtct ccccttgaat tcatacaaag aagatagcca gatgatagca atccgagttc     46860
     acgcaatatg tggtgaaatt tattattgta aaataacaac ccatacccaa ttagctcaac     46920
     gggtccaccg cgaactcatt taatttagct actgcaatat cacaccttgc gtgtataaaa     46980
     ccaaacatcc tttctttcgt gaaagaaagg atgtttggtt agaatcggaa tcagcaaaca     47040
     aacacatgta atagtaatga caatactgta ttatttgtat tcaacaaaaa aagtcaagag     47100
     attaatacta attagtgcta gttatgttta attgtaaaat gcacaggaga aatacaatca     47160
     ccatacttta tatatggttt taaatcgcat catatattcc taatataagt gaacctcttg     47220
     ttggttaacc atatcgaata aattacatat tcccaatagc cggtgttaat caccccattt     47280
     ttccgataaa aaacatagac tagaaagtag aggaaatagt atagaccaac aaaaatgcca     47340
     tctgttttaa ccatattcct agttacattg cagcctatta taacatttcg gaatgctgtt     47400
     tctcgatatt ttgcctttct agccatcgta gcacttcagc tgtggcctct atttgctcag     47460
     ccggaatata gtgatcgacg agcgcatccc aataaagagc acgggctaat gggatacgtt     47520
     gtaaaatagg caccccttct tcttctgcta ttttgcgcac agtctgaact tgggcatcgg     47580
     tatatttgaa tgttaccaac ggtagtggtg tttcccctcg cttataaaga ataccaatag     47640
     caatatgggt cggattagct accaccactg atgagcgttt aacattttcc cgcatgttcc     47700
     ccgattggat ctcttgatga aactgacggc gcttgctttt gatttctggg ctaccctcca     47760
     tttctttgta ctcgcgtttg atctcatcct tgctcatttt aagttcctta atatattgat     47820
     agtattcaaa ggcatagtca gctatggaga tgaccacaaa gccaacagta cagatcacca     47880
     tcaactgccg gagtatttgc cccaataaag gggtaataca ttcaattcca caggttggca     47940
     actgcaagag tgtgaccaga tttcccttaa tgattatcca gatgagtata ctgagcaaaa     48000
     caaccttgag aatggatttg agaaactcca ctaaactttt gatggaaaag atacgcttgg     48060
     caccctctat tggattgatt tttttaatat ccggtttaat tgcttcacca cttataagaa     48120
     aaccatactg cacaacatga gaagcgatcg ccatcaatgc cgccactgtt aacaaaggaa     48180
     aacagagata aaaaaactcg agcaacacat tgtcaaccac atagctaagc gcctgcgaga     48240
     aaggaagata gctctgctct gcggggatta gcattagcct actcaaatgc tcgaaatagt     48300
     agtcagaaag ccccattaac atcgcactca gcgcgacgat aagcgtagta gagaccactt     48360
     ccttactttt cgctacctgt ccctttttgc gcgcatcacg gattttcttc ggggtgggtt     48420
     gctctgtctt ttctccgctc attacttctc caaaacaggg atcagtaaac ttataggatc     48480
     cataaccaac agcattgctt tactggcatg actcatcatt tgcatacagt agataaccaa     48540
     caacaggctt gctatcgcgc tttttatcgg catagccagc acaaagacgt ttaaagaagg     48600
     cgcaaaacga ctgatgagtg caagtccaaa ttcagctaaa aacatagcga tgagtaaagg     48660
     agcagccaat acagcggcga ttaatagtat ctggctgaat tggttataaa agaaatcaac     48720
     ccactgttca ctaacttcag ggaaaaagct ggccaccggc caatttacat agctgtgaaa     48780
     gagggctgaa agcaaagaga ggaaagcccc tccgcagaag aaaattgtta ttaacgtttg     48840
     agtcaaaagt aaaccagtcg gactagtttg actatcaagt ccagggttga gtagagatgc     48900
     catcgcggca cctctttggt tatctacaat aaatcctgcg gattctaagg cccagaaagg     48960
     gatggtggcc acaaacccaa tcaataaccc cagtatgaac tctttgccga taagcagcat     49020
     caacgtaaac gcatcaacct caatataagg ttggttagcg acggcaggat agacataaag     49080
     agccaatgaa cagacaatac cattacgcag caatactcca ccgaggagct gtttacttaa     49140
     cactggcaat ataacaaaac aagccataaa acgaggcaac agcagggtat aagtgagcaa     49200
     tggtctttgg attaaatccg ctatcatctt atgccttgta tcttcatcat ggtcatttct     49260
     gcaaaactgt gcaattcatt accaagccac gaggcggtag caaacagtgt gaccaccaca     49320
     gcgatcaatt tgataacgaa gcccagagtt tgctcttgga tttgcgttaa agcttgtact     49380
     aaagatacca aagttcctac caccgcagcc actaacaccg gcggcattga aaggactagc     49440
     accagccata atgcctgact ggtgaagtga attatgtcac cttgactcat gtcaccctcc     49500
     gtaactaatc accagcccat gcgtgagtcg tgtccaacca tcaagtaaaa caaatagcag     49560
     caatttaaat ggcagtgaaa tagtcatggg ggaaaccatc atcatcccca ttgccaacaa     49620
     gatattggaa ataaccaggt caatgacgat aaatggtaaa tagatgagaa agcctatctc     49680
     aaatgctcga gtcaactcac tcaccgtaaa cgcaggcaat aaaatgaaca ggctgtctga     49740
     ctctaaccgg tcagcatact gcttgggcca taactgttta gtgctgtcaa caaaaaaaga     49800
     gtattcttgc gcttgaatat gctgcttaag gaacatgcga tagggggcaa gcccttcatc     49860
     aaagaatttc tcaacagatt ctatgttcgt gaggctaacc tcattagctt gtaaatagtc     49920
     ttgcgtcgcg aagccaacag gtgccattac ataaagacta aggatgattg ctaagccata     49980
     cattgccatg ttggggggga tttgctgtac cccaagggca ttgcggagta gtgaaaaaac     50040
     caccgcaaat ttgacaaacg atgtagccat taccgaaacc aatggaagca aagtcagcaa     50100
     agataaaatg atgatgagat taatttcatc cggtaactgg atcatgaaat cgtaacctct     50160
     gtcaggcgtt caattcgaac cccgaggcgt ccttggatct cgaccaatcg accatgtcca     50220
     agcaaccggc cgttagccag caagcgcact tcaccatcaa caggtgttgt aagatcaata     50280
     agagaacccg gctccaggct agtgagtgtg tgccaatcta agatttgccg ccccacttca     50340
     aagctaactt gaaccggaag ttggttcaaa tcggtcaatg gtttggggtt aagttcgtca     50400
     gattcatgac tcataccgat aaactccaat ttatttgatt gtaattgaaa gtagccccaa     50460
     gggttctcac caacataggc gagtactggc gaattaggcc cactcccctc agggaccaac     50520
     aacacatcac ctaatcgaag ggaatcaacc tcatctagag tcaggtatac tttgtgccaa     50580
     cgcaaagaaa gaaggatagg caaaggtatg cgctcagaat tgggtcgtgc gggtaacaga     50640
     gcgaacagag cctcagctga ggttagccag aaggagatat gcgcattatc tcgggacagc     50700
     cgcaaactca acagaggttg cgtgacagaa agagacgctg tcgctatatc attacagacc     50760
     agtttcggca ggaaaactgt ctggcgttcc aacagcgcaa gttgcaactc tttcggcaga     50820
     gtagagaatg gagcccctag taagtcgggg gttaaccagt tagccagatc atcgccaaaa     50880
     cagtagagcg tgaagtgcgt tcccttccat tgtaactgta atatacagtt caaagacgaa     50940
     ggaggctcag agacggtaag ttcgagtttt ccctcttccc acaagtagtt ttgtcgataa     51000
     tggctgagcc gttgacgtag cgacagttca cttaatttgg cttgtggcaa ggttaacaaa     51060
     ctcattcttc agcctcccac tcctcataga cgtggcgctt ctgacgtgac tcctgttcac     51120
     tgtcaccgct agcttgaaaa tcaagttgtg ttggctcaat gcgttgtaat cgctcaagaa     51180
     ggtcataact tccctgcgct aaaattctta aagcttcctg actggcgatc agttctacat     51240
     gcagttttcc cggaatctca gcaatacgaa ccataatagc ccccaattca ggtaagttaa     51300
     ggtgtaattg ggttacttgg gatgagccgc cgcgcagttc tagttctacc gctagtcgct     51360
     gtgctaactg tataagttgc tctgagactg atgtcagcct cgtcgcgcgc attgttgcta     51420
     ataggtgatc acccggcgtg acaaccggtg ctgtaaaaga caaggaatac atctccagca     51480
     aggtttcttc gcgcggaagt aacagttctt ctggtcgcgg tggttcgatg gtatctttgc     51540
     tgctatcaac gccatcagtc agatattgtg accgagccgc cagctcggtc atgtccagtt     51600
     gctctgactg cactgttgct ttgtgcggaa aacgagcaga tttttctgct acctctggca     51660
     atgcttcttg atgaagaggt aacggttctt ctggtcgcgg tagttcgatg gtatctttgc     51720
     tgctatcaac gccatcagta agatgttgtg accgatccgc cagctcggtc atgtccagtt     51780
     gctctgactg cactatcgct ttgtgcagaa aacgagcaga tttttctgct acctcagcca     51840
     caggagtagc acaccatctt gctaccaaat gatcattcgg tgtggcacta actgccgggg     51900
     gacatacctc tggcaatgct tcttgatgaa gaggtaacgg ttcttctgca aggcgttttt     51960
     gcctgctatc gcgctggttt tttgcgatgc tggctggagt ttccctaccg acagaccaca     52020
     caataacctc tgcgccgtca gcagcaggat tcaatggctg aacagtcggc ttggtattca     52080
     attgaactgg ctgaacggaa tctataggcg attgctgaac aaataactca tcatgtccag     52140
     acggctcgca gggggattca cttgatgtcc ccgtttcaca agtcaccccc tctaaaaagg     52200
     gtgccaatgg catgagagca ttaataatac tctctacgcg gtcatcaaaa cggctatcct     52260
     gctggtataa gtgcgctcta ttggtaacac cttcggcaag cggagataag tttaaatcat     52320
     gattattctg atggttgtgt tgaggtttta atcctacctc tttcctaccg ggttgaaacg     52380
     tcgcctctaa tggcgcatgc gcacgcaagc catctccttt ctgaccttct tttttgccaa     52440
     ggtcatgcgg acgtacaggt ctacgcggct cttctttggg atgacgatta cccttattat     52500
     tatgcaacag cgcttgctca aaatcggcac gtgcttgcaa atcatgatgc ggcttcccca     52560
     gaggttgata ctcaggttct aatggggaac gagtggtgat tttattcatt aggcgttcct     52620
     gtgatgctgt agaaactctt cttgttcttg ttcttcctga taatgttgtt gatttagctc     52680
     attttcatct tctcgttgca ctagctcaag aaacttattt tccttatgac gagcctgttg     52740
     caacgtcttt tggcataacg taaggcgctc acgctcattg gctaaacatt ccaataattt     52800
     ggcgcactcc agttcataat tggcctcctt ttcacgtagc gacgctattt gtcgctgcca     52860
     tttctccaaa tctttacaat tcagtgtggt gttttttcgc tgatcaaata gacgttgctc     52920
     ctcatcaata cgccacaaat ggtaatcctg actggtttgc accgcctctt gatgacgtcg     52980
     atgagctgcc tgcaagcaag cttgctgagt cttgatggct tgctccgcac gttcaacgcg     53040
     taaaacttta acccggtgca ggcggcgtat cattgggtca gcgtctccaa taagttcagc     53100
     gtctcattga aatggcttaa ctcgtgcgtc ccctggcaga gccatcctcg aatcgcccct     53160
     atgcgttcaa tcgcttgatc ggcctctttg tcttgccctt tctggtactc cccgatttgc     53220
     aacaacaatt ccacttcttc atatttggcc aataaacggc gtaagtcccc cgcccaagtt     53280
     ttgtgctcct tgctgacaat ttgattcatc accctgctcg ctgaacgtaa tacgtcaatg     53340
     gcagggtaat gattagctgc cgctaatttc cgtgacagaa taatatgacc atcaagtatc     53400
     gaacgtgttt cgtcggccac gggttcggtc atatcgtccc cttcgaccag tacggtatag     53460
     agagccgtaa ttgacccttt gctggactga ccagcccttt ccatcaaacg gggtaaagcg     53520
     gcaaatactg acggaggata accgcggcga gtcggtggtt ctcccgcggc taagcctatt     53580
     tcacgctgag cacgagcaaa ccgtgttaca gagtccataa gtaacaatac gcgcttccct     53640
     tgatcgcgaa aatattcagc aatagatgtc gccacgaatc cagctttggc tctttccatt     53700
     gagggccgat ccgaggtggc caccactaga accgctttgc gtaacccctc ttcgcctaaa     53760
     tcagactcaa taaactcacg cacttcgcgt ccacgctcac caataagcgc cagcacggtt     53820
     acgtctactt cagcactacg aataagcgaa gcaagcagtg tacttttccc ccccccggcg     53880
     gccgcgaaga tgcccattct ttgcccctcg ccacaggtaa gcaaaccgtc aataacccgg     53940
     atccccaaag aaagtggtgt ggtaataagt tttcggctca tcggagctgg ggcatcctga     54000
     taaactgggt accaagccgc cggttcaggg agatgccccc catcgaaagg ctgccctaaa     54060
     ccatccaaca cctgccccag cagatgttca cccaccccaa cctgatgcat tgtccctgtc     54120
     gggctaactt cagtattaga agatatcccg tacatttcac caagtggaat aagtaatgct     54180
     tgatgttggg caaaacctat gacttcagcc tgtaaagaca ggctgttgtc tgggttacgt     54240
     aagtaacata actcaccgat gcgcacacca ggcactaccg cttttaatag cgttcctgtc     54300
     acttgagtga cacgtcctct aatttggatt aggcggctac ctacaatgcc atgacgaata     54360
     tgatgaggta tctgatctag tgagagcata aatccataat ggttgaaata ttaaccacta     54420
     ttttagtgac taaaaacgct aaaaaattgt agcgggagcc gcgagttttt agaaaaatag     54480
     ccaagcagca ctaaaatttc tcggctgatt ttggcatcga taagcaagaa ctatttttat     54540
     aatcgcggta attgcaatta taaaccgttc atcttaggga gtagttatga cgacgcttca     54600
     taacctatct tatggcaata ccccgctgcg taatgagcat ccagagattg ccagtagtca     54660
     gatcgtaaat cagactctgg gtcaatttcg gggagaatct gtgcagatag tcagcggcac     54720
     tctgcagtct atagctgata tggcagaaga ggtaacattt gtcttctccg agcgtaagga     54780
     gctctccctc gacaaacgca aattaagtga cagccaagct cgagttagcg acgttgagga     54840
     gcaggttaat caatacctta gcaaagttcc agagttgaaa caaaaacaga atgtgagtga     54900
     gctgctcagt ctgttgagta acagccccaa tataagcttg tcccagttaa aggcttatct     54960
     ggaggggaaa tcagaagaac cgagtgagca attcaaaatg ctctgcggct tgcgtgatgc     55020
     cctgaaaggg cgccctgaat tagcacatct tttgcatttg gttgaacaag ctctggtcag     55080
     catggttgaa gagcaagaag aagccattgt attgggtgcc agaataaccc cggaagcgta     55140
     cagagaatcc cagtcgggtg ttaatccact gcagccgctc cgtgatacct accgcgatgc     55200
     agtgatgggt tatcaaggga ttaatgcgat ctggagtgat ttacaaaaac gttttcccaa     55260
     tggggatata gactcggtga tattattcct gcaaaaggcg cttagtgcag atctacaaag     55320
     tcaacaaagc gggtctgaac gggaaaaatt agaaatagtt attagtgact tacagaagct     55380
     aaaggagttt cgtagcgtga gtgaccaggt taaaggattt tggcaacttt tttcagaggg     55440
     tataactaat ggcttacgac ctttctgagt ttatgggaga tattgtcgca ctggttgaca     55500
     agcgctgggc ggggattcat gacattgaac atcttgccaa cgccttttcc cttcctacgc     55560
     ctgaaatcaa agtgcgtttc tatcaagatt taaaaagaat gtttcgtctt ttccctctgg     55620
     gggtatttag cgatgaggag caacggcaaa atttattgca aatgtgtcaa aatgcgatcg     55680
     atatggctat tgagagtgaa gaggaagaat tgagtgagtt ggattgaacc catcatttcc     55740
     catttctgcc aggatctggg agtgccaaca tctagccccc tttcgcctct tattcaatta     55800
     gagatggctc aatctggcac gctgcaactg gaacaacatg gtgcgacact gacactgtgg     55860
     ttagcgcgtt ctctcgcctg gcaccagtgc gaagatgcta tggtcaaagc gctaacgctc     55920
     acggcggccc aaaagagtgg cgctttaccg ctgcgagcgg ggtggttagg ggaaaatcaa     55980
     ctggtgttat ttgtctcgct tgatgagcgt tccttaacct tgcccctttt acatcaagct     56040
     ttcgaacagt tactgcgatt gcagcaagag gtgcttgcgc cgtgagtcgc ataataactg     56100
     ccccccatat tggcatcgaa aaactgtcgg cgattagcct ggaagagcta tcctgtggct     56160
     tgcctgatcg ttatgccttg ccgcctgatg ggcatccagt cgaaccacat ttagagcgcc     56220
     tttaccctac agcacaaagc aagcgtagcc tatgggactt tgcttctccc ggctatacat     56280
     ttcatggatt acatcgagct caagattatc ggcgcgaact ggataccttg cagtcactgc     56340
     taaccaccag tcagtcctca gagctacaag ctgccgcggc gctgctgaaa tgccaacaag     56400
     atgatgatcg gttactgcaa ataatcctta acctgttgca caaagtatga atattacttt     56460
     aaccaaacga caacaggagt tcttgctgct caacggttgg ttacaactac aatgtggcca     56520
     tgcagagcgc gcatgtattc tattggacgc cttgctgacg ttaaatcctg agcatttagc     56580
     cggtcggcgt tgccgattag tcgcgctact taataataac cagggagaac gtgccgaaaa     56640
     agaagcgcaa tggctaatat cacatgaccc tttacaggct ggaaattggc tctgcttgag     56700
     ccgtgcccaa caactgaacg gcgatcttga taaggctcgc catgcttatc aacattattt     56760
     ggagttgaaa gatcataatg aatccccatg atcttgagtg gctaaatcgt attggcgagc     56820
     gtaaagatat catgctggca gtgctgctgt tagctgtggt attcatgatg gtcttaccac     56880
     tcccccccct cgtgttggac attctgattg ctgttaacat gaccatctca gtggtgttgt     56940
     taatgatagc gatctatatc aactctcctt tacaattttc agctttccca gcggtgctac     57000
     tcgttaccac gttatttcgt ctcgcacttt cagttagcac cacccgcatg atcctgctac     57060
     aagctgatgc ggggcagatt gtttacacct ttggtaattt cgtcgttggc ggtaacctca     57120
     tcgtcgggat tgtcatcttc ctgatcatca ctattgtgca atttttagtg ataacgaaag     57180
     gctcagaacg tgtagcagaa gttagtgcca gattctctct tgatgcgatg ccgggtaaac     57240
     agatgagtat cgatggcgat atgcgagccg gggtgatcga tgtcaatgaa gcgcgtgagc     57300
     ggcgcgcgac gatagaaaaa gaaagccaaa tgttcggttc tatggacggc gccatgaagt     57360
     tcgtcaaagg ggatgcaata gctggcctca ttattatctt tgtcaatata ttaggcggcg     57420
     tcaccattgg tgttacccaa aaaggattag cggccgctga ggcactgcaa ctctattcca     57480
     tcctcactgt cggggatggg atggtttctc aggtacctgc cctgctgata gctattaccg     57540
     cgggtattat cgtcacccgc gtctcttcag aagattcatc agacttgggt agcgatattg     57600
     gcaaacaggt tgtcgctcag cctaaagcca tgctaattgg tggcgtactg ctgttgctct     57660
     ttggtcttat ccccggcttc ccaacagtca cctttctgat tttggcgcta ttggtaggct     57720
     gtggtggtta tatgctcagc cgtaagcaga gtcgtaatga cgaagctaat caagacctgc     57780
     aatccatact gacgagcggt tctggtgccc cggctgcccg aaccaaagcc aaaacaagtg     57840
     gggcaaacaa gggccgacta ggggaacaag aagcatttgc tatgacggtt cccttgctga     57900
     ttgatgtaga ttcaagccaa caggaagcac tggaagcaat agcactaaat gatgagctgg     57960
     ttcgagtgcg ccgtgctctt tatcttgatc ttggcgtacc tttccctggg atccatctgc     58020
     gttttaatga ggggatgggt gaaggcgaat atcttatttc cttgcaagaa gttcctgtgg     58080
     cgcgaggtga gcttaaggca ggttatttac tcgtgcgtga atccgtcagc caactcgaat     58140
     tactgggtat accctatgaa aaaggggaac atttgctacc cgatcaggaa actttctggg     58200
     tatcggttga atatgaggag cgcctggaaa agtctcaact ggaatttttc tctcattccc     58260
     aagttctaac ctggcatctt tctcatgtcc tacgtgaata tgccgaagat ttcattggta     58320
     tccaagaaac ccgctatctg ctcgaacaga tggaaggagg ctatggcgaa ttaattaaag     58380
     aagtacaaag aatcgttccc ttacaacgaa tgaccgaaat attacaacga ttagttggag     58440
     aagatatttc tatccgtaat atgcggtcta ttcttgaagc tatggtggaa tggggacaaa     58500
     aggagaaaga cgtcgttcaa ctcacagaat atatccgcag tagtctaaaa cgttatatct     58560
     gctacaaata cgctaatggc aacaatatat tgccagctta tcttttcgat caagaagtag     58620
     aagaaaaaat tcgtagcggt gtgcgccaaa ccagtgcagg gagttatttg gcattggatc     58680
     ctgctgttac cgagagttta cttgaacaag tccgcaagac tattggcgat ctgtcgcaaa     58740
     tccagagtaa accggtgctg attgtttcta tggatattcg tcgctatgtg cgcaaactga     58800
     ttgagagcga atactatggc ttgccggtac tttcatacca agagctgact cagcagatta     58860
     atatccaacc acttggacga gtttgcttat gatggaagac cctttaattc cgtggcttac     58920
     cgaacatggc ttggtttgcc accctcatac tttgtctggc acccccattt ctttaggttc     58980
     ggcctttcaa ttagctggcc tcaagcttgc ctggcgcgta gaaattgaac aaaggcgggt     59040
     ttggatcgtg cttatccaac gagtggaaca acgtcgaggg ctgaaaaatc ccttcgcggc     59100
     actttatatg ttagctaatg cagcgcgggc cgttcttggc cctgactatt atctgtatgg     59160
     caatgtcgat gtactggcgg ggagttctct cagtacgcaa cggctcgctc atttttatcg     59220
     gcgttggacc ggggccaaag aattaagcac cgggtggttc tcactaaaag tatcacaagt     59280
     catcacctta tctaatatga aaaagcgaca aaacaacggc tttgcctgac aagctaaata     59340
     aaaataacgt aataaaatag gaggtagatt atgaaatctt cccattttga tgaatatgac     59400
     aaaacgctta aacaagcaga aatggcaata gccgatagcg atcaccgcgc aaaattattg     59460
     caagaaatgt gtgctgatat cggcttaacg cctgaagccg taatgaagat atttgcgggc     59520
     cgttccgccg aagagataaa gccagcggag cgcgagttgc ttgatgaaat taagcgtcag     59580
     agggagaggc agcctcaaca tcccaacgat gggaagagac caaaaaaacc aacgatgatg     59640
     cgagggcaaa ttatttaata tgattagagc ctacgaacaa aacccacaac attttattga     59700
     ggatctagaa aaagttaggg tggaacaact tactggtcat ggttcttcag ttttagaaga     59760
     attggttcag ttagtcaaag ataaaaagat agatatttcc attaaatatg atcccaaaaa     59820
     agattcggaa gtttttgcca atagggtaat tactgatgat atcgaattac tcaagaaaat     59880
     cctggcttat tttctacccg aggatgccat tcttaaaggc ggtcattatg acaaccaact     59940
     gcaaaatggc atcaagcgag taaaagagtt ccttgaatca tcgccgaata cacaatggga     60000
     gttgcgggcg ttcatggcag taatgcattt ctctttaacc gccgatcgta tcgatgatga     60060
     tattttgaaa gtgattgttg attcaatgaa tcatcatggt gatgcccgta gcaagttgcg     60120
     tgaagaatta gctgagctta ccgccgaatt aaaaatttat tcagttattc aagctgaaat     60180
     taataagcat ctgtcgaata gtgacaccat aaatatccat gataaatcaa ttaatctcat     60240
     ggataaaaat ttatatggtt atacaaatga agagattttt aaagccagcg cagagtacaa     60300
     aattctcgag aaaatgtctc aaaccaccat taaggaaggt gagaccgaaa aaaaaatagt     60360
     ctcgataaag aactttcttg aaagtgagaa taaaagaacc ggggcgttgg gtaacctgaa     60420
     agattcatac tcttataata aagataataa tgaattatct cactttgcca ccacctgctc     60480
     ggataagtcc aggccgctca acgacttggt tagccaaaaa acaactcagc tgtctgatat     60540
     tacatcacgt tttaattcag ctattgaagc actgaaccgt ttcattcaga aatatgattc     60600
     agtgatgcaa cgtctgctag atgacacgag gtaattatgc aacaagagac gacagacact     60660
     caagaatacc agctggcaat ggaatccttc ctaaaaggag ggggaactat cgccatgctc     60720
     aacgaaattt caagtgacac tttagagcaa ctctactctc ttgcgtttaa ccaataccag     60780
     tcaggaaaat acgaggatgc tcacaaggtc tttcaagctc tctgtgtgct agaccactat     60840
     gattcacgtt tctttttagg gctaggcgct tgtcgtcaag ccatggggca atacgactta     60900
     gcgattcata gctacagcta tggtgccgta atggatataa aagaacctcg ttttccgttt     60960
     catgcggccg aatgtttact gcaaaaggga gagcttgctg aagcagaaag tggcttgttc     61020
     ttggctcaag agcttatcgc aaacaaacct gagtttaagg agctttccac ccgagttagc     61080
     tcaatgttag aagcaattaa attgaaaaag gagatggaac atgagtgcgt tgataaccca     61140
     tgatcgctca acgccagtaa ctggaagtct agttccctac atcgagacac cagcgcccgc     61200
     cccccttcag acccaacaag tcgcgggaga actgaaggat aaaaatggcg gggtgagttc     61260
     tcagggcgtg cagctccctg caccactagc agtggttgcc agccaagtca ctgaaggaca     61320
     acagcaagaa atcactaaat tattggagtc ggtcacccgc ggcacggcag gatctcaact     61380
     gatatcaaat tatgtttcag tgctaacgaa ttttacgctc gcttcacctg atacatttga     61440
     gattgagtta ggtaagctag tttctaattt agaagaagta cgcaaagaca taaaaatcgc     61500
     tgatattcag cgtcttcatg aacaaaacat gaagaaaatt gaagagaatc aagagaaaat     61560
     caaagaaaca gaagagaatg ccaagcaagt caagaaatcc ggcatggcat caaagatttt     61620
     tggctggctc agcgccatag cctcagtggt tatcggtgcc atcatgatgg cctcaggggt     61680
     aggagccgtt gccggtgcaa tgatgattgc ctcaggcgta attgggatgg cgaatatggc     61740
     tgtgaaacaa gcggcggaag atggcctgat atcccaagag gcaatgcaag tattagggcc     61800
     gatactcact gcgattgaag tcgcattgac tgtagtttca accgtaatga cctttggtgg     61860
     ttcggcacta aaatgcctgg ctgatattgg cgcaaaactc ggtgctaaca ccgcaagtct     61920
     tgctgctaaa ggagccgagt tttcggccaa agttgcccaa atttcgacag gcatatcaaa     61980
     cactgtcgga agtgcagtga ctaaattagg gggcagtttt ggtagtttaa caatgagcca     62040
     tgtaatccgt acaggatcac aggcaacaca agtcgccgtt ggtgtgggca gcggaataac     62100
     tcagaccatc aataataaaa aacaagctga tttacaacat aataacgctg atttggcctt     62160
     gaacaaggca gacatggcag cgttacaaag tattattgac cgactcaaag aagagttatc     62220
     ccatttgtca gagtcacatc aacaagtgat ggaactgatt ttccagatga ttaatgcaaa     62280
     aggtgacatg ctgcataatt tggccggcag accccatact gtttaagttt aaggaggaat     62340
     aacaatgaca ataaatatca agacagacag cccaattatc acgaccggtt cacagcttga     62400
     tgccatcact acagagacag tcgggcaaag cggtgaggtt aaaaaaacag aagacacccg     62460
     tcatgaagca caagcaataa agagtagcga ggcaagctta tctcggtcac aggtgcctga     62520
     attgatcaaa ccgagtcagg gaatcaatgt tgcattactg agtaaaagcc agggagatct     62580
     taatggtact ttaagtatct tgttgttgct gttggaactg gcacgtaaag cgcgagaaat     62640
     gggtttgcaa caaagggata tagaaaataa agctactatt tctgcccaaa aggagcaggt     62700
     agcggagatg gtcagcggtg caaaactgat gatcgccatg gcggtggtgt ctggcatcat     62760
     ggctgctact tctacggttg ctagtgcttt ttctatagcg aaagaggtga aaatagttaa     62820
     acaggaacaa attctaaaca gtaacattgc cggccgtgat caacttattg atacaaaaat     62880
     gcagcaaatg agtaacgctg gtgataaagc ggtaagcaga gaggatatcg ggagaatatg     62940
     gaaaccagag caggtagcgg atcaaaataa gctggcatta ttggataaag aattcagaat     63000
     gaccgactca aaagccaatg cgtttaatgc cgcaacgcag ccgttaggac aaatggcaaa     63060
     cagtgcgatt caagttcatc aagggtattc tcaagccgag gtcaaagaaa aagaagtcaa     63120
     tgcaagtatt gctgccaacg agaagcaaaa agccgaagag gcgatgaact ataatgataa     63180
     ctttatgaaa gatgtcctgc gcttgattga acaatatgtt agcagtcata ctcacgccat     63240
     gaaagccgct tttggtgttg tctgaccatt tatgaccttg gttagttaat taaccgaaag     63300
     ttttatttta ccttacgcct tatggtgata gaacttatct atataaggta aaggtgctga     63360
     aaagccctgg attaatatta gttaatccag ggctttgatt attaacttaa aaataataag     63420
     ttatgatcat atgacaatta aaataaaaga ttatttacat gtagtagctc aagacctgag     63480
     ctgacagtta tcttaatgcc attaatcaaa cagttaacca aagtcacact gactgccgaa     63540
     ctcgactcat acctggctct ggacatcgaa gccaatcgca aaaatggttc gtccagaaaa     63600
     acggtcaaaa ctcccactgg tacgtttgaa ctcgccacgc ctcgtgatcg caatggaact     63660
     tttgagcctc aactggtaat ggggccaaca atattcagtg gtactccagt cgtggcggaa     63720
     aaatgagcca atttgtcgtg ttacttccga tatccgacaa cgatccgtga ggtcatttac     63780
     atgacaaatg ccattgaatc ggtacatcgg ctgttcagaa agctgacaaa aacgaaagga     63840
     gttttcccta atgaaaacag tctattgaaa ttactgtgta tgggattaat gaatgcgcag     63900
     gaaaaatgga caatgccgat ccagagctgg aatttgacat tgtcccagtt ggcgatttat     63960
     tttgaaggtc gcctggataa agtgattacg ttgtaatgat attttaaacg tgacacagaa     64020
     ttatgaacgc tcttgcgcac tactcaaata catcatcttc aagtttgtct atagtctcat     64080
     gagcaaattc atatggatca attacacgtt cagagtccat ccgaagatct tccactgact     64140
     caggtatatc gggaaactct ctcagagcgt tgtactctac gtggagcagt ttcaggtttt     64200
     gcggcaattc aggtacttca gcaagatgat taaatgaagc gattaaacgt tctaagcgtg     64260
     gaggtaacgc tggcagttcg atcaactgat tatctctgac atcaagttct accagtgaag     64320
     ggggtaaatc gcataaagat cttatttcat tgctggatgc attgagatta tacaagtttg     64380
     gtggcaattc cgataatcca gaaaaaatat tatcagaaac atctaagaag gttaaactct     64440
     gcggtaattc tggcagatca gttaaataat tttctctgac attaagtgtt ttcagggaag     64500
     ggggtaaatc gggtaatgtt ttcagtgaat tgttatcagc ataaatcgca gtcaagaagg     64560
     gcaagttttg caactctgac aattcttcca gctgattatt accagcagca agaaattcca     64620
     gtgaaggagg taaatcaggt aatgttttca gtgaattgtt atcaacatca atagatgtca     64680
     agaaggacga gttttgcaac tctggtaatt cttccagctg attattagcg gcacctaaat     64740
     attccagtaa aggaggtaaa tcggataatg ccttcagatt gttattatca acttgaagtg     64800
     atttcaggct ctgcggcaat tccggtaatt ctgtaagaga attacatgac gccactaaac     64860
     tctctaaatg cggaggtaat tccggcaaag aactcagccc cagattattt agttctagct     64920
     catgggcttg tcggtccagg caatcgcgta accttgaaac cgccattccc ctctgttcac     64980
     cattccccgg aggggcattt cgttcccatt ccgaccatgc attataatat tcagccttag     65040
     atttaacatt ttctgcctca actggcatct cagttaaatc agaagaatga cgtaatggtt     65100
     cttgcaaaaa agtattagat acatttcttg ggtttataaa catattgaat gcctttctga     65160
     aaatatcttt attatcggtt ttttcattgc aaatgaaacc atacatatta aatatatata     65220
     tatatatagt ttttcgtcga aaatttttat gcgttactta tccaaattta gctcttctac     65280
     cattgaaagt ttttggccat ttttatgcat aaatcaccag aagaaatatg tcagaagtat     65340
     tgtatggccg ctatttttag attctcgaca aaaccattta gcatcggtta tcctggttgg     65400
     ataacaccca acaccacaaa attatttact cggtataata tcaccataaa cttaccaacc     65460
     aatggcaata ccgccaccga tgcaatctct gcattgatat tcttggtgtt attattaatg     65520
     ctgttatcca gtttttactg gccgcagaat caaccttacc gcaatatcat taaactttaa     65580
     atcagtgtat tttggggagg tagtttcaat accggccatc tgctctttag ttttttcaat     65640
     ggtttcattt ctcaatgtaa ttcctgatct ataacaccac ttatagcatc tctgtttacc     65700
     ttctgagtag tataattatt agcatctttc aatgttgagt ctgctttatt attggtatag     65760
     gtattggcac tgtccaatgt attactgctg acggtgttag tatactgttt ggctgtatcc     65820
     cgagcccctt tcctgagtac gcctggtcta tagccaatcg tccgagaaca attgtcccac     65880
     tatgggtttg ttgcaaaaaa tggatttgtc atgaaaactg aaagaaggaa agatacggga     65940
     tgctgcaaag cagcggcaag tcaaatacct gaataatcgt atcgagtctc tgaccatgcc     66000
     cccatcaaaa aattgataaa cgcgatcggg ggtttcaaac ggccaaaccg tgcccggtca     66060
     acgcttcagg gatttgaaac attgcgacga ctgaataaag gtcaatttga tatttgatta     66120
     cgccgtgacg aacctgaata tcgaatgcgg gaaggatcta cctttatgaa tcggctcttt     66180
     aacattgagg ttgttttagc ctaattattc cacccatcaa tgagtaaaat taccgactct     66240
     cattatttgc agcaaacccg ccgaaattgc tgtagggcac tttattacca tgagcattaa     66300
     ggctacatta ttatattcat atcaggaata tggtcagcac accgatgttt ttattcaagt     66360
     aaagtttaat tatggtgtga tagaatctaa attctatgta aataaagtaa aattcgataa     66420
     taccaccgga cagaaagctc aagacaacga tagctcactc tcctcagctc atggggcata     66480
     atctaaccta cgaggacgat gcaatgaaaa aacgactagt gatagccgcc gcattgtgcg     66540
     ctgcttttta tgctggtatg aaagttgagc actttctgac agtagatgct tgcctggatt     66600
     gctggccgag ctatgcagaa tgatatcttc tgtgaacgtt aaggcgatag cgacgccacc     66660
     gttgataaaa aaaacaaaaa aatatccatc aattaagcag caattatctt tatcaaatat     66720
     cattgacatg agttaccaaa tgtaaaaaat attttttaca ttgaaaccag ttaaacacat     66780
     aaataaaacc accaaacaag atactgtcca cttcccgtta tctgagacaa acctgattag     66840
     agttttctag ctgttttcgg tatgtctccg ggggaagatg ccccagactt tcatgggtac     66900
     gattcaggtt ataatcctgc cgccagaacc agaccatttc tctgacctga cataaataag     66960
     catccaaaaa ttcccggcga aatgaaccat taaaacgttc aatgaatcca ttctgctgcg     67020
     ggtttacccg gttgaatatg gcacaaagta ataccattat attcacagta attcagtaag     67080
     ttaaccgata tcagttccgg accattatca actctaattt gctgaggctg tccacgttct     67140
     tctttcagac gttcaagtac gcggatcact ctgtttgctg gcaaagaagt atcgacttca     67200
     atagccaggc attcacgtgt accctcatca ataatattca atgttctgaa tcgtttgccg     67260
     caatacagag catcatgcac aaaatccatc gcccactgaa tattcggttt attcacaaca     67320
     gataacgggt ttttctcacg ttttggcagc gtttttttga ctttgcgttt aaggtttaaa     67380
     cctaatcggc aatacacacg ataaacacgt ttatggttga atatataacc cttaaatctg     67440
     agccggtaat agcatttcca gaagccagcc tgaggagact cagacaaaac gacatgaata     67500
     gcatcgatca ctgccttatc tttttcccgc cagtcagccc tgcgacgaca aaaagatgcg     67560
     cgtgataaag aggtcagttt acaagccgta ataaccgata gacctgaagc cgttaatagc     67620
     ccggcgcagg attttttctc ggttactacc aacccttttt tgcaaaaagc tccttcatgg     67680
     cgtgattttc cagactgact tcagcaaaga gttttttcag tcgagcattt tcatcttcaa     67740
     gttcttttaa ttttttaaca tcatcagctt ccatacttgg atttccaatt ataataggtc     67800
     gcattactta ttccgttctg acgacagatt tcttcaactt tcatgcctga atcagcaagc     67860
     ttcagaatgt taacaatctg agtttcagta aaacgtgctt ttttcatttt gacctctgca     67920
     aatgtaaagg cagaaaatcc aattatagct gtctcatttt aggggaagtg gacactttaa     67980
     gctgctgaat ttcgcgttgg tcaggtgtga tggcattgcc aacaggttca attccctgaa     68040
     gttcctgctt atacagccgt atccatttgc gcagatggtc agggttgagt tcgagcgctt     68100
     gcgcgactta ccgataacct acagtggcga ctgtgtccgc aggtacgggt ggctgacata     68160
     gtgaaggttt cctcatcgtg aagatccggt agccgggagt ggtggcaact gttccgactg     68220
     gttgcgcagt ggtattgtga tgtggtcatt accgatcgtg atggaggtat tgtcgccgcc     68280
     gtcgaacttg acgattgcag tcatcaggca tcgcatcgcc aacgtcggga cctgttgctg     68340
     gaagaggtac tgcgtcaggc tgacattccc ctgctgcgca gtaaggacga aggtgtcctg     68400
     gtggcgaacg ttcagacatt tttggccact gtagagcaga ggcaaaacgt atgaacgatc     68460
     atccggctgt tccactgttc cactgttccc tgcccgttat ttgctcaatt tgtctccgtt     68520
     acagcgggac gttatccgga tggtggcctt tatggcgatg gttggggacc acatcgcgac     68580
     ggcatttcag ctagatatgc ctttactcaa tctgttagga cgttgtgcct ttccgctgtt     68640
     tgctctggtt agcggctgca atctggctgg ccattgtctg cgtcagtctt ctcttaatcg     68700
     gctatggctg atggcgttgc ttgctcagct cagctcagct cagctcagct cagctcgggt     68760
     ttgggttagc attctaggag gcgggggttc tgtagtggat cagtaattta ggacacctcg     68820
     aaatcctgtt aatgttaaaa cagtgaacat gaggtgatga atgatcgaaa ctcgtcggac     68880
     taaacgcaca ttttccccgg agttcaaact cgaagctatc gagcaggtgg ttaaatacca     68940
     acgagatgta tggtaagtcg cgtaagcgct cgaactcaac cctgaccatc tgcgcaaatg     69000
     gatacggctg tataagcagg aacttcaggg aattgaacct gttggcaatg ccatcacacc     69060
     tgaccaacgc gaaattcagc agcttaaagc acagataaag caccttgaga tggaaaaaga     69120
     aatactaaag acaggcggcc gtcgctgatg agcgaaaatt ccccgggaaa cactcgcgct     69180
     aatcacacgg ctgaaagcaa cgtggcctgt gttggtttct ttgtcattta ttcggtattc     69240
     accgtagcct ttattacgcg caggtgaaga aacccgttga tgtacaaaga attgagttac     69300
     gaagtcgggt gagagcattc catgccctca gtcgtggcgc tgccggtagt cgggcaatca     69360
     gccagatgct gcgtcagagt ggggctgatg caggccgatg gctggcacga cgcccgattc     69420
     aggaatgcgg gctgacgagt agacagtagg ttaaacacca ctaccgaata aacgatgaca     69480
     tcagtccggc gctgccaaac ttgttgcgcc ggcagtttaa cccggtcgga ccaaaccgtg     69540
     tctgctgtgg tgatatcagc tttattcgcc tgcagggaaa atggtactat ctcgcgcttg     69600
     tcgttgattt atatgcgcgc cgaattatcg gttcagccct ctcattaacc gccgatgcgg     69660
     atttggtgtg cagggctttg cgtaatgccc tggaaacacg gccacgtgac aggcatctgt     69720
     tgtttcattc ggatcagggt tgtcagtata aaagacaata aaaacagaaa gttactcttg     69780
     cgtcatgggg taatgcaaag tatgagtcgc agaggaaatt gcctggataa ttcagcgatg     69840
     gaaagagtct ttcgtagcct taaaagtgaa tggcttccca aaggcggtta tggtgattta     69900
     gccatgcgat acgcgatata aaccaatgga taaatggtta ttacaatgtg taccgccctc     69960
     atacgaacaa tgggggctta tcgccttctt gtatgaagaa aagtggaaac aggttattcc     70020
     ggtgtcctga ttttgtgttt gcgccagcgt atgttgactg aacacgatgc actgatgtca     70080
     cggtatgctg ctgtccacac actattacag catcctgatg cctccgcgtt gctctgttgt     70140
     ccaaccccgg aaaaggggaa aagcaagttt tcctctcttt cggggtttca attacttcaa     70200
     taacaagagg ttctcatgaa attgcatttc gtcagcagac tgttgttgcc cagtctggtg     70260
     tgtctaatct tgtccggaat gttacccgct tcagctacgc cagccattga aaccgggttt     70320
     tcccccgaag gcagtgcact acagctggtt cttaaagtcg tgaacactgc gcaacagaat     70380
     atccgtctga tggggtattc attcacctca ccagcggtcg ttcggtcact cattagtgcg     70440
     aaacgtcgag gggtagatat tcaggttgta ctggatgaaa aagcgaacgt tggcaaagcc     70500
     agcgtggccg caatggatct gttggtcaat accggcattc ctgtccgaac tgccaacagt     70560
     ttcaaagcgc ttcacgacaa ggtgattatc gttgatggca agaatacgca ggtggggtcg     70620
     ttcaatttta gccaagcagc cgtacagtcc aactcggaga atgtgctgat tatatggggg     70680
     gacttcacgg tggtacaggc gtatctgcag cattggcagt cacgctggaa taaagggact     70740
     gactggcgtt cgtcgtactg atctcactct tttcgctgag tcattaatgt gatccgtgcg     70800
     ccaacacgag ttatgtctgc aaaagttaag tcgctgattt cataaatctg ttgtatcctc     70860
     tgcgaaacga tccttgtttg agctttgagg gggctgagat gtcgcagatc gaaaatgcag     70920
     taacttcctc atcgaaacgt gcctacagaa aggggaaccc gttaactgga gccgagaaac     70980
     aacgtatgtc tgtttcccgg aaaaaagaga cacataaagc tataaatgtg ttcattcaga     71040
     acgatctcaa aaacgaactt ttacaactct gtgaggattc aggtttgact cagacagaaa     71100
     tgattgagcg ctggattcag agagaaaagg ccgctaggac taatgcagct tgaatggcaa     71160
     ctaagttact ttcttgatcc ttcaggcagt gagtgctaga ttaccgatcg tttaaagaat     71220
     ttttggctgg ccacgccgta aggtggcagg gaactggttc tgctaaggtg tttacttgga     71280
     accagaaaag caaaaacccc gataaacttc ctcatctttg gcgaggcgag aaggttaccg     71340
     gggcccactt aaaactgtat agaagctgtt gctctataca gggagtatat gtgcatgctc     71400
     agaaaagttc aataccttct gcgcttgtta ctccttccgt gcaacataag tgcgggaagg     71460
     tgtgactgac caccaggccc tgttcacaca tcattatcga caggttaaaa acccgaatcc     71520
     ggaatttacg ccgcgagagg gtaaaaaaac cctgccgttc tgccgtaagc tgatggcgaa     71580
     agccgaaggc ttcacatctc gttttgattt ctccatgcac gtcgcattcg cgcgttctct     71640
     gagtttgcgt catcgtatgc cgccgttact acgtcggcgt gctatcgatg cattactgca     71700
     gggtatgtgt ttccactacg acccactggc caaccgtatc cagcgctcta ttaccaatct     71760
     ggccattgag tgcggtctgg cgacagagtc aaagagtggc aacctttcca tcacccgcgc     71820
     cacgcgtgcg ctgcgctttt tatctgagct ggggctgatt acctaccaga ccgaatatga     71880
     tccacagatt ggctgtaata ttccgactga tatcacgttc acaccggcgc tgttttctgc     71940
     gttggatgtg tcggacgttg ctgtcgcagc agcccgacgc agccgcgttg aatgggaaaa     72000
     tcagcaaagg gagaaacaac gtctgcctag attggagatg gatgagctga tagcaaaggc     72060
     atggcggttc gtccgcgagc gtttccgtag ctatcaaact gaacgtaagg ctcatggatt     72120
     gaaacgtgcc cgtgcgcgcc gtgatgttga ccgtacgcgc cgtgacattg aagctatcgt     72180
     taaccggcag ctgacgcgtg agatagctga ggggcggttt gtcggcaatc tggatgcggt     72240
     acgcagggag aaagcccgtc gcgtgaagga acgcatgctg atgtccagga acaataacta     72300
     cacccggttg accaccggcg ctacctgacg tcgtatttac tgaaaatccg gttagcgccg     72360
     gagggtttcg ctcgtctgcc tcctgtcagt gcttgttatt tgagcgatgt gacggccgct     72420
     acacgaccta tcttctcttt cccgccctga aaatgtcctc                           72460
//


spacer
spacer