Dbfetch

ID   FR731127; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR731127;
XX
DT   10-DEC-2010 (Rel. 107, Created)
DT   10-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB3 gene for MHC class II antigen, allele
DE   HLA-DRB3*02new, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (26-NOV-2010) to the INSDC.
RL   McWhinnie A.J., HLA Group, Anthony Nolan Research Institute, Fleet Road,
RL   Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Poole K., McWhinnie A.J.;
RT   "A new HLA-DRB3 allele DRB3*02XX which differs from DRB3*0215 with G305C,
RT   C307G and A308C resulting in coding changes at codons 73 and 74";
RL   Unpublished.
XX
DR   MD5; f8ce633c94a0f9eb7d31133565db964c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E5BD18"
FT                   /db_xref="IMGT/HLA:DRB3*02:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E5BD18"
FT                   /protein_id="CBY44990.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 65 C; 100 G; 48 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//