Dbfetch

ID   FR729731; SV 1; linear; genomic DNA; STD; INV; 639 BP.
XX
AC   FR729731;
XX
DT   09-NOV-2012 (Rel. 114, Created)
DT   09-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Metacrangonyx longipes mitochondrial partial COI gene for cytochrome
DE   oxidase subunit 1, isolate BX02
XX
KW   .
XX
OS   Metacrangonyx longipes
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Malacostraca;
OC   Eumalacostraca; Peracarida; Amphipoda; Senticaudata; Hadziida; Hadzioidea;
OC   Metacrangonyctidae; Metacrangonyx.
OG   Mitochondrion
XX
RN   [1]
RP   1-639
RA   Bauza-Ribot M.;
RT   ;
RL   Submitted (26-NOV-2010) to the INSDC.
RL   Bauza-Ribot M., Biology, Universitat de les Illes Balears, Ctra.Valldemossa
RL   km 7.5, 07122, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-11-221.
RX   PUBMED; 21791038.
RA   Bauza-Ribot M., Jaume D., Fornos J.J., Juan C., Pons J.;
RT   "Islands beneath islands: phylogeography of a groundwater amphipod
RT   crustacean in the Balearic archipelago";
RL   BMC Evol. Biol. 11:221-221(2011).
XX
DR   MD5; a81188c560f59ddd7b703a232e303905.
DR   EuropePMC; PMC3161010; 21791038.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..639
FT                   /organism="Metacrangonyx longipes"
FT                   /organelle="mitochondrion"
FT                   /isolate="BX02"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:510302"
FT   CDS             <1..>639
FT                   /codon_start=1
FT                   /transl_table=5
FT                   /gene="COI"
FT                   /product="cytochrome oxidase subunit 1"
FT                   /db_xref="GOA:K7ZTA5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:K7ZTA5"
FT                   /protein_id="CBY44486.1"
FT                   /translation="FILGAWASMVGTAMSVIIRMELSYPGNLIGDDQLYNVVVTAHAFV
FT                   MIFFMVMPIMIGGFGNWLLPLMLGSPDMAFPRMNNMSFWLLPPSFMFLFMSSMVESGVG
FT                   TGWTVYPPLSSLIAHSGSSVDMAIFSLHMAGISSILGAINFISTVLNMRVGMMAMDQIT
FT                   LFTWSIFITVILLLLSLPVLAGAITMLLTDRNLNTSFFDPSGGGDPILYQ"
XX
SQ   Sequence 639 BP; 174 A; 95 C; 116 G; 254 T; 0 other;
     tttattttag gtgcatgagc taggatggta ggaactgcta taagagtaat tattcggata        60
     gaacttagat accctggtaa tttgattgga gacgaccaat tatataatgt agttgtaact       120
     gctcacgctt ttgttataat tttttttata gttataccaa ttataattgg ggggtttgga       180
     aactgactgc ttcctttaat attaggtagg cctgatatag cctttcctcg gataaataat       240
     ataagatttt gacttcttcc tccttctttt atatttttgt ttataagaag aatagtagaa       300
     agaggtgttg gtacaggatg aactgtttat cctcctttgt caagactgat tgcccataga       360
     gggtcttctg ttgatatagc aattttttct ttacatatag ccggtatttc gtctatttta       420
     ggggctatta attttatttc tactgtatta aatatacggg ttggaataat agcaatagac       480
     caaatcactc tttttacatg gtctattttt attactgtaa ttttattatt gttatcactt       540
     cctgttttgg ctggggctat tactatatta ttaactgacc gaaatctaaa cacctccttt       600
     tttgacccta gtggaggtgg agaccctatt ttataccaa                              639
//