spacer

EBI Dbfetch

ID   FR729668; SV 1; linear; genomic DNA; STD; INV; 661 BP.
XX
AC   FR729668;
XX
DT   24-JAN-2011 (Rel. 107, Created)
DT   27-APR-2011 (Rel. 108, Last updated, Version 2)
XX
DE   Brachionus sp. Almenara mitochondrial partial COI gene for cytochrome
DE   oxidase subunit 1, isolate Indianrocks1
XX
KW   .
XX
OS   Brachionus sp. Almenara
OC   Eukaryota; Metazoa; Lophotrochozoa; Rotifera; Monogononta; Ploimida;
OC   Brachionidae; Brachionus.
OG   Mitochondrion
XX
RN   [1]
RP   1-661
RA   Riss S.;
RT   ;
RL   Submitted (24-NOV-2010) to the INSDC.
RL   Riss S., Institute for Limnology, Austrian Academy of Sciences,
RL   Herzog-Odilo Str. 101, 5310 Mondsee, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-11-90.
RX   PUBMED; 21473744.
RA   Stelzer C.P., Riss S., Stadler P.;
RT   "Genome size evolution at the speciation level: the cryptic species complex
RT   Brachionus plicatilis (Rotifera)";
RL   BMC Evol. Biol. 11(1):90-90(2011).
XX
DR   MD5; ecc9008c9e8c7ea762708afd2f6708e6.
DR   EuropePMC; PMC3087684; 21473744.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..661
FT                   /organism="Brachionus sp. Almenara"
FT                   /organelle="mitochondrion"
FT                   /isolate="Indianrocks1"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:Indian Rocks Beach, Florida"
FT                   /db_xref="taxon:183145"
FT   CDS             <1..>661
FT                   /codon_start=2
FT                   /transl_table=5
FT                   /gene="COI"
FT                   /product="cytochrome oxidase subunit 1"
FT                   /db_xref="GOA:E8ZG32"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:E8ZG32"
FT                   /protein_id="CBY44284.1"
FT                   /translation="TLYFIFGIWAGLIGLSMSFLIRLELGVVGSYIGDEHLYNVLVTAH
FT                   AFVMIFFMVMPVSMGGFGNWLIPLMLGVADMAFPRMNNLSFWLLVPAFLLLLLSSAIDA
FT                   GAGTGWTVYPPLSDSTYHAGVSVDLAIFSLHLSGISSILGSINFLTTIICSRTTKSVSL
FT                   DRLPLMLWAIAVTAVLLITSLPVLAGAITMLLTDRNFNTSFFDPAGGGNPVLYQHLF"
XX
SQ   Sequence 661 BP; 146 A; 108 C; 110 G; 296 T; 1 other;
     tactttatat tttattttcg gtatttgagc tggtcttatt ggattgagta taagattttt        60
     aattcgttta gagttaggtg ttgttggttc ttatattggt gatgagcatt tatataatgt       120
     actcgttact gctcacgctt ttgttatgat tttctttatg gttatacctg tgtctatagg       180
     tggttttgga aattgattaa ttccattaat attaggagtt gctgatatag cattccctcg       240
     tataaataat ttatctttct gattactagt tcccgccttt ttacttcttt tactgtcctc       300
     tgctattgat gcaggtgcag gtacgggttg aactgtttac ccccctctct cagattctac       360
     ttaccatgct ggtgtttctg tagatctagc tatttttagt ttacacttat ctggtatttc       420
     ttctatctta ggtagaatta attttttaac tactattatt tgttctcgta ctacaaaaag       480
     agtttctctt gatcgtttac ctttaatgtt atgagctatt gctgttacag ctgttttact       540
     aattactagt cttccwgttc ttgctggtgc aattacaata ctccttacag atcgtaattt       600
     taatacttct ttctttgatc ctgcaggtgg aggtaatcct gttttatacc aacatttatt       660
     t                                                                       661
//


spacer
spacer