spacer

EBI Dbfetch

ID   FR729477; SV 2; circular; genomic DNA; STD; PRO; 4553420 BP.
XX
AC   FR729477;
XX
PR   Project:PRJEA60483;
XX
DT   14-JAN-2011 (Rel. 107, Created)
DT   12-APR-2011 (Rel. 108, Last updated, Version 3)
XX
DE   Yersinia enterocolitica subsp. palearctica Y11
XX
KW   complete genome.
XX
OS   Yersinia enterocolitica subsp. palearctica Y11
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-4553420
RA   Batzilla J.;
RT   ;
RL   Submitted (24-NOV-2010) to the INSDC.
RL   Batzilla J., Max von Pettenkofer-Institute, LMU, Pettenkoferstrasse 9a,
RL   Munich, D-80336, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.01484-10.
RX   PUBMED; 21296963.
RA   Batzilla J., Hoper D., Antonenka U., Heesemann J., Rakin A.;
RT   "Complete genome sequence of Yersinia enterocolitica subsp. palearctica
RT   serogroup O:3";
RL   J. Bacteriol. 193(8):2067-2067(2011).
XX
DR   MD5; 061da8c41dec34c16bc66ae216683482.
DR   BioSample; SAMEA2271938.
DR   EnsemblGenomes-Gn; Y11_r00170.
DR   EnsemblGenomes-Gn; Y11_r00190.
DR   EnsemblGenomes-Gn; Y11_r00200.
DR   EnsemblGenomes-Gn; Y11_r01810.
DR   EnsemblGenomes-Gn; Y11_r01840.
DR   EnsemblGenomes-Gn; Y11_r01850.
DR   EnsemblGenomes-Gn; Y11_r07900.
DR   EnsemblGenomes-Gn; Y11_r07920.
DR   EnsemblGenomes-Gn; Y11_r07930.
DR   EnsemblGenomes-Gn; Y11_r32290.
DR   EnsemblGenomes-Gn; Y11_r32300.
DR   EnsemblGenomes-Gn; Y11_r32320.
DR   EnsemblGenomes-Gn; Y11_r38660.
DR   EnsemblGenomes-Gn; Y11_r38680.
DR   EnsemblGenomes-Gn; Y11_r38690.
DR   EnsemblGenomes-Gn; Y11_r38720.
DR   EnsemblGenomes-Gn; Y11_r39100.
DR   EnsemblGenomes-Gn; Y11_r39110.
DR   EnsemblGenomes-Gn; Y11_r39130.
DR   EnsemblGenomes-Gn; Y11_r40690.
DR   EnsemblGenomes-Gn; Y11_r40700.
DR   EnsemblGenomes-Gn; Y11_r40730.
DR   EnsemblGenomes-Gn; Y11_t00180.
DR   EnsemblGenomes-Gn; Y11_t01820.
DR   EnsemblGenomes-Gn; Y11_t01830.
DR   EnsemblGenomes-Gn; Y11_t04610.
DR   EnsemblGenomes-Gn; Y11_t06240.
DR   EnsemblGenomes-Gn; Y11_t07620.
DR   EnsemblGenomes-Gn; Y11_t07630.
DR   EnsemblGenomes-Gn; Y11_t07640.
DR   EnsemblGenomes-Gn; Y11_t07910.
DR   EnsemblGenomes-Gn; Y11_t10190.
DR   EnsemblGenomes-Gn; Y11_t10800.
DR   EnsemblGenomes-Gn; Y11_t10810.
DR   EnsemblGenomes-Gn; Y11_t10820.
DR   EnsemblGenomes-Gn; Y11_t10830.
DR   EnsemblGenomes-Gn; Y11_t10840.
DR   EnsemblGenomes-Gn; Y11_t10850.
DR   EnsemblGenomes-Gn; Y11_t11460.
DR   EnsemblGenomes-Gn; Y11_t14460.
DR   EnsemblGenomes-Gn; Y11_t14720.
DR   EnsemblGenomes-Gn; Y11_t14930.
DR   EnsemblGenomes-Gn; Y11_t16300.
DR   EnsemblGenomes-Gn; Y11_t16430.
DR   EnsemblGenomes-Gn; Y11_t16440.
DR   EnsemblGenomes-Gn; Y11_t16450.
DR   EnsemblGenomes-Gn; Y11_t17500.
DR   EnsemblGenomes-Gn; Y11_t17520.
DR   EnsemblGenomes-Gn; Y11_t18870.
DR   EnsemblGenomes-Gn; Y11_t21760.
DR   EnsemblGenomes-Gn; Y11_t21770.
DR   EnsemblGenomes-Gn; Y11_t25250.
DR   EnsemblGenomes-Gn; Y11_t27100.
DR   EnsemblGenomes-Gn; Y11_t27300.
DR   EnsemblGenomes-Gn; Y11_t27310.
DR   EnsemblGenomes-Gn; Y11_t28790.
DR   EnsemblGenomes-Gn; Y11_t29250.
DR   EnsemblGenomes-Gn; Y11_t29260.
DR   EnsemblGenomes-Gn; Y11_t29270.
DR   EnsemblGenomes-Gn; Y11_t29280.
DR   EnsemblGenomes-Gn; Y11_t29310.
DR   EnsemblGenomes-Gn; Y11_t32120.
DR   EnsemblGenomes-Gn; Y11_t32280.
DR   EnsemblGenomes-Gn; Y11_t32310.
DR   EnsemblGenomes-Gn; Y11_t32880.
DR   EnsemblGenomes-Gn; Y11_t33580.
DR   EnsemblGenomes-Gn; Y11_t35770.
DR   EnsemblGenomes-Gn; Y11_t35780.
DR   EnsemblGenomes-Gn; Y11_t36360.
DR   EnsemblGenomes-Gn; Y11_t37050.
DR   EnsemblGenomes-Gn; Y11_t37060.
DR   EnsemblGenomes-Gn; Y11_t37710.
DR   EnsemblGenomes-Gn; Y11_t37720.
DR   EnsemblGenomes-Gn; Y11_t37980.
DR   EnsemblGenomes-Gn; Y11_t38670.
DR   EnsemblGenomes-Gn; Y11_t38700.
DR   EnsemblGenomes-Gn; Y11_t38710.
DR   EnsemblGenomes-Gn; Y11_t38990.
DR   EnsemblGenomes-Gn; Y11_t39000.
DR   EnsemblGenomes-Gn; Y11_t39010.
DR   EnsemblGenomes-Gn; Y11_t39020.
DR   EnsemblGenomes-Gn; Y11_t39120.
DR   EnsemblGenomes-Gn; Y11_t40130.
DR   EnsemblGenomes-Gn; Y11_t40140.
DR   EnsemblGenomes-Gn; Y11_t40150.
DR   EnsemblGenomes-Gn; Y11_t40160.
DR   EnsemblGenomes-Gn; Y11_t40670.
DR   EnsemblGenomes-Gn; Y11_t40680.
DR   EnsemblGenomes-Gn; Y11_t40710.
DR   EnsemblGenomes-Gn; Y11_t40720.
DR   EnsemblGenomes-Gn; Y11_t43020.
DR   EnsemblGenomes-Gn; Y11_t43400.
DR   EnsemblGenomes-Tr; Y11_r00170.
DR   EnsemblGenomes-Tr; Y11_r00190.
DR   EnsemblGenomes-Tr; Y11_r00200.
DR   EnsemblGenomes-Tr; Y11_r01810.
DR   EnsemblGenomes-Tr; Y11_r01840.
DR   EnsemblGenomes-Tr; Y11_r01850.
DR   EnsemblGenomes-Tr; Y11_r07900.
DR   EnsemblGenomes-Tr; Y11_r07920.
DR   EnsemblGenomes-Tr; Y11_r07930.
DR   EnsemblGenomes-Tr; Y11_r32290.
DR   EnsemblGenomes-Tr; Y11_r32300.
DR   EnsemblGenomes-Tr; Y11_r32320.
DR   EnsemblGenomes-Tr; Y11_r38660.
DR   EnsemblGenomes-Tr; Y11_r38680.
DR   EnsemblGenomes-Tr; Y11_r38690.
DR   EnsemblGenomes-Tr; Y11_r38720.
DR   EnsemblGenomes-Tr; Y11_r39100.
DR   EnsemblGenomes-Tr; Y11_r39110.
DR   EnsemblGenomes-Tr; Y11_r39130.
DR   EnsemblGenomes-Tr; Y11_r40690.
DR   EnsemblGenomes-Tr; Y11_r40700.
DR   EnsemblGenomes-Tr; Y11_r40730.
DR   EnsemblGenomes-Tr; Y11_t00180.
DR   EnsemblGenomes-Tr; Y11_t01820.
DR   EnsemblGenomes-Tr; Y11_t01830.
DR   EnsemblGenomes-Tr; Y11_t04610.
DR   EnsemblGenomes-Tr; Y11_t06240.
DR   EnsemblGenomes-Tr; Y11_t07620.
DR   EnsemblGenomes-Tr; Y11_t07630.
DR   EnsemblGenomes-Tr; Y11_t07640.
DR   EnsemblGenomes-Tr; Y11_t07910.
DR   EnsemblGenomes-Tr; Y11_t10190.
DR   EnsemblGenomes-Tr; Y11_t10800.
DR   EnsemblGenomes-Tr; Y11_t10810.
DR   EnsemblGenomes-Tr; Y11_t10820.
DR   EnsemblGenomes-Tr; Y11_t10830.
DR   EnsemblGenomes-Tr; Y11_t10840.
DR   EnsemblGenomes-Tr; Y11_t10850.
DR   EnsemblGenomes-Tr; Y11_t11460.
DR   EnsemblGenomes-Tr; Y11_t14460.
DR   EnsemblGenomes-Tr; Y11_t14720.
DR   EnsemblGenomes-Tr; Y11_t14930.
DR   EnsemblGenomes-Tr; Y11_t16300.
DR   EnsemblGenomes-Tr; Y11_t16430.
DR   EnsemblGenomes-Tr; Y11_t16440.
DR   EnsemblGenomes-Tr; Y11_t16450.
DR   EnsemblGenomes-Tr; Y11_t17500.
DR   EnsemblGenomes-Tr; Y11_t17520.
DR   EnsemblGenomes-Tr; Y11_t18870.
DR   EnsemblGenomes-Tr; Y11_t21760.
DR   EnsemblGenomes-Tr; Y11_t21770.
DR   EnsemblGenomes-Tr; Y11_t25250.
DR   EnsemblGenomes-Tr; Y11_t27100.
DR   EnsemblGenomes-Tr; Y11_t27300.
DR   EnsemblGenomes-Tr; Y11_t27310.
DR   EnsemblGenomes-Tr; Y11_t28790.
DR   EnsemblGenomes-Tr; Y11_t29250.
DR   EnsemblGenomes-Tr; Y11_t29260.
DR   EnsemblGenomes-Tr; Y11_t29270.
DR   EnsemblGenomes-Tr; Y11_t29280.
DR   EnsemblGenomes-Tr; Y11_t29310.
DR   EnsemblGenomes-Tr; Y11_t32120.
DR   EnsemblGenomes-Tr; Y11_t32280.
DR   EnsemblGenomes-Tr; Y11_t32310.
DR   EnsemblGenomes-Tr; Y11_t32880.
DR   EnsemblGenomes-Tr; Y11_t33580.
DR   EnsemblGenomes-Tr; Y11_t35770.
DR   EnsemblGenomes-Tr; Y11_t35780.
DR   EnsemblGenomes-Tr; Y11_t36360.
DR   EnsemblGenomes-Tr; Y11_t37050.
DR   EnsemblGenomes-Tr; Y11_t37060.
DR   EnsemblGenomes-Tr; Y11_t37710.
DR   EnsemblGenomes-Tr; Y11_t37720.
DR   EnsemblGenomes-Tr; Y11_t37980.
DR   EnsemblGenomes-Tr; Y11_t38670.
DR   EnsemblGenomes-Tr; Y11_t38700.
DR   EnsemblGenomes-Tr; Y11_t38710.
DR   EnsemblGenomes-Tr; Y11_t38990.
DR   EnsemblGenomes-Tr; Y11_t39000.
DR   EnsemblGenomes-Tr; Y11_t39010.
DR   EnsemblGenomes-Tr; Y11_t39020.
DR   EnsemblGenomes-Tr; Y11_t39120.
DR   EnsemblGenomes-Tr; Y11_t40130.
DR   EnsemblGenomes-Tr; Y11_t40140.
DR   EnsemblGenomes-Tr; Y11_t40150.
DR   EnsemblGenomes-Tr; Y11_t40160.
DR   EnsemblGenomes-Tr; Y11_t40670.
DR   EnsemblGenomes-Tr; Y11_t40680.
DR   EnsemblGenomes-Tr; Y11_t40710.
DR   EnsemblGenomes-Tr; Y11_t40720.
DR   EnsemblGenomes-Tr; Y11_t43020.
DR   EnsemblGenomes-Tr; Y11_t43400.
DR   EuropePMC; PMC3133053; 21296963.
DR   EuropePMC; PMC3161016; 21733159.
DR   EuropePMC; PMC3469391; 22963272.
DR   EuropePMC; PMC3995578; 24628971.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02228; sX9.
DR   SILVA-LSU; FR729477.
DR   SILVA-SSU; FR729477.
DR   StrainInfo; 163438; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4553420
FT                   /organism="Yersinia enterocolitica subsp. palearctica Y11"
FT                   /sub_species="palearctica"
FT                   /strain="Y11"
FT                   /serotype="0:3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:930944"
FT   CDS             1..720
FT                   /transl_table=11
FT                   /locus_tag="Y11_00001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28181"
FT                   /db_xref="GOA:E7B1K2"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR022864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1K2"
FT                   /protein_id="CBY28181.1"
FT                   /translation="MLVEVLLNTPAQLSLPLYLPDDETFASFYPGENPSLLAAIQSAVR
FT                   QSHGSYIYFWSREGGGRSHLLHAACAELSQKGEAVGYVPLDKRAYFVPEVLDGMEQLAL
FT                   VCIDNIECIAGDEQWEMAMFNLYNRIVETGRTRLLITGDRPPRQLNLGLPDLASRLDWG
FT                   QIYKLQPLSDDEKLQALQLRAKLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASI
FT                   TAQRKLTIPFVKEILSL"
FT   CDS             complement(768..1121)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00011"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28180"
FT                   /db_xref="GOA:E7B1K1"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1K1"
FT                   /protein_id="CBY28180.1"
FT                   /translation="MKDVTIYHNPRCSKSRETLALVEQQGIKPQVVLYLETPPSVAALK
FT                   ELLQQLGFSDARQLMRTKEELYKELNLGDKALTQEQLLQAMSDNPKLIERPIVVYHGKA
FT                   RIGRPPEQVLEIL"
FT   CDS             complement(1133..2659)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00021"
FT                   /product="exported zinc metalloprotease YfgC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28179"
FT                   /db_xref="GOA:E7B1K0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1K0"
FT                   /protein_id="CBY28179.1"
FT                   /translation="MTVQLNKISQLNKTGRFNKTGRLSKTVIATLLSSLLLTGSLPVNA
FT                   DTQTQDLLPDIGTSAGATLSIDQEKAMGDFYVRQMRASAPLIYDPLLTQYINSLGNRLV
FT                   ANAYSVRTPFHFYLVNNDQINAFAFFGGNVVLHSALFRYTENESELASVLAHEISHVTQ
FT                   RHLARAMEEQQRMAPLTWVGVLGSILLTMASPQAGMAGLSGTLAGAQQGIISFTQGNEQ
FT                   EADRIGIQVLQRSGFDPQAMPNFLQKLADQSRYASKPPEMLLTHPLPDSRLSDARNRAN
FT                   QMKPHPIASSQDYLFAKVRILGMYGSTENSLTPDLLETLSKGTTREQLAAKYGQAILLY
FT                   QAKKYDEARNQLQPLLTQQPGNVWFLDLMTDIDLGQNKAASAISRLQAATAKQNNDPVL
FT                   LLNLANAYVQGAQPAAAIKILRNYTFRYPNDPNGWDLLAQAAAALGLRDQELAARAESL
FT                   ALSGKLTQAIGLLSDASARVKLGSLEQARYDARIDQLRQLNERFRKYQKS"
FT   CDS             3012..4076
FT                   /transl_table=11
FT                   /locus_tag="Y11_00031"
FT                   /product="putative permease PerM (=YfgO)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28178"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J9"
FT                   /protein_id="CBY28178.1"
FT                   /translation="MLELLLQWYRRRFTDPQVIALLVILLAGFCILYFFSGILAPLLAA
FT                   IVLAYLLEWPTARLQRIGCSRPWAASIVLVVFGGIALLAVFVVAPTVWQQGNNLLSDMP
FT                   KMLNKFNAFAQTLPARYPALVDAGIVDMMAENLRSKLSGMGESVVKFSLASLIGLLTLA
FT                   IYLILVPLMLFFLLKDKEQMLNAVRRILPRNRGLAGQVWLEMNQQITNYIRGKVLEMVV
FT                   VGVATYLVFFVLGMNYALLLAVLVGFSVLIPYIGAVIVTIPVVLVALFQWGIGADFWTL
FT                   FVAYLVVQGLDGNLLVPVLFSEAVNLHPLVIILSVIIFGGMWGFWGVFFAIPLATLVKA
FT                   VIHAWPEEFIPDAD"
FT   CDS             4158..4313
FT                   /transl_table=11
FT                   /locus_tag="Y11_00041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28177"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J8"
FT                   /protein_id="CBY28177.1"
FT                   /translation="MSSLAALLQQQWLWGSFDLLPIKRALLRLMTSHANSTLQGEDGQK
FT                   SKAFAA"
FT   CDS             complement(4441..4911)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00051"
FT                   /product="thiol peroxidase, Bcp-type"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28176"
FT                   /db_xref="GOA:E7B1J7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J7"
FT                   /protein_id="CBY28176.1"
FT                   /translation="MSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPG
FT                   CTVQACGLRDNMDELKKAGVEVLGISTDKPEKLSRFAEKELLNFTLLSDENHEVAEQFG
FT                   VWGEKSFMGKTYDGIHRISFLIGIDGKVEHVFDNFKTTNHHEIVMDYLRQSA"
FT   CDS             complement(4914..5483)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00061"
FT                   /product="glycine cleavage system transcriptional
FT                   antiactivator GcvR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28175"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J6"
FT                   /protein_id="CBY28175.1"
FT                   /translation="MPQLDEHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMFG
FT                   EEFTFIMLLSGSWNAITLLESTLPQKGAELDLLIVMKRTNAQNQKAMPATVWVKVEVND
FT                   SPHIIERFTNLFHCHNMNIAELVSKTQPAEGDIPPRLHIQISAHSPASQNSSIIEHAFY
FT                   QLCTELNAQGSISVVNYPQHDSRMES"
FT   CDS             5648..6529
FT                   /transl_table=11
FT                   /locus_tag="Y11_00071"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28174"
FT                   /db_xref="GOA:E7B1J5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J5"
FT                   /protein_id="CBY28174.1"
FT                   /translation="MFTGSIVALITPMDDKGNVDRASLKKLIDYHVASGTAAIVSVGTT
FT                   GESATLNHDEHVDVVLQTLELADGRIPVIAGTGANATSEAISLTQRFNDTGVVGCLTVT
FT                   PYYNRPMQEGLYQHFKAIAESTDLPQILYNVPSRTGCDMLPPTIARLAKIKNIVAVKEA
FT                   TGNLSRVSQIQVLVDDEDFILLSGDDASGLDFMQLGGQGVISVTANIAAREMVELCALA
FT                   AQGNFAEARRLNQRLMPLHQHLFVEANPIPVKWAAKKLGLMANDTLRLPMTSLTDPAKR
FT                   VVEDALKSAGLL"
FT   CDS             6546..7604
FT                   /transl_table=11
FT                   /locus_tag="Y11_00081"
FT                   /product="outer membrane protein NlpB, lipoprotein
FT                   component of the protein assembly complex (forms a complex
FT                   with YaeT, YfiO, and YfgL); Lipoprotein-34 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28173"
FT                   /db_xref="GOA:E7B1J4"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR014524"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J4"
FT                   /protein_id="CBY28173.1"
FT                   /translation="MAITLQKSTVVTVVGVSLAMLLAGCTTDQRYKRQVGGDESYLEAP
FT                   GLKPLNSPAGMILPVQNGEYDVRSVNTQGAVGKQLDIRPPVQPLALLSGSRAENANDTS
FT                   KLLLENSPQNRNLWAQVTRVLQDKNWAIASRQDASQTLTTDWVKWNRADEDVQFEGRYQ
FT                   ISVQEQGYQLALVVKSLELQQGGKPVTSYTEIQRYNGAMLNAIIEGLDKVRSDSENNQA
FT                   ARTAGALDVQSGSDDTGLPQLIVRAPYAVLWERLPNALEKVGMKVTDRSRPLGTINVTV
FT                   KSMSSSSWDALGAKDPELPTGDYKLQVGDLGNRSSLQFIGPKGQTLTQSQNDALVAVFQ
FT                   AALSQTSAASTN"
FT   CDS             7817..8530
FT                   /transl_table=11
FT                   /locus_tag="Y11_00091"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28172"
FT                   /db_xref="GOA:E7B1J3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J3"
FT                   /protein_id="CBY28172.1"
FT                   /translation="MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDR
FT                   KGMVNNKFNHFIMAKLEEAGIPTQMESLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKR
FT                   LGIEEGLELNPPLFDLFLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLS
FT                   KLFDDAGLILVDFKLEFGLFNGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLI
FT                   EAYEEVAHRIGVKLD"
FT   CDS             8732..9601
FT                   /transl_table=11
FT                   /locus_tag="Y11_00101"
FT                   /product="ypfj protein, zinc metalloprotease superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28171"
FT                   /db_xref="GOA:E7B1J2"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J2"
FT                   /protein_id="CBY28171.1"
FT                   /translation="MRWQGRRESDNVEDRRGNSSGGGGGFRPPIGGKGGLVILIVVLVA
FT                   GYYGVDLTPLLNGGDPLSQTQTQPRSQGSVSAQDDQYAKFTSVVLADTEDTWKPIFQKM
FT                   GRNYQEPKLVMYRGATRTGCGTGQSVMGPFYCPADSTVYIDLSFYEDMKNKLGADGDFA
FT                   QAYVIAHEVGHHVQHLMGIDTKVRQQQQGASEAEANRLSVKMELQADCFAGVWGKAMEK
FT                   QNVLEIGDLQEALNAAQAIGDDRLQQQHQGRVVPDSFTHGTSAQRYTWFKRGFDSGDPN
FT                   SCNTFATR"
FT   CDS             9739..10191
FT                   /transl_table=11
FT                   /locus_tag="Y11_00111"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28170"
FT                   /db_xref="GOA:E7B1J1"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J1"
FT                   /protein_id="CBY28170.1"
FT                   /translation="MAALDPTLLILLVLAGLGIISHNMTVTLAILTLIAVRITPLNQFF
FT                   PWIEKYGLTIGILILTIGVMTPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRG
FT                   VSLMTHQPSVVAGLLVGTVLGVALFRGVPVGPLIAAGLLSLIIGKS"
FT   CDS             10193..12199
FT                   /transl_table=11
FT                   /locus_tag="Y11_00121"
FT                   /product="putative P-loop ATPase fused to an
FT                   acetyltransferase COG1444"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28169"
FT                   /db_xref="GOA:E7B1J0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027992"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1J0"
FT                   /protein_id="CBY28169.1"
FT                   /translation="MINGIIASQALMAQQGHRRLLVLSGDADWARQQAIHLSEQLPGDW
FT                   LWVGDNFPPGANGIRPTAAKTLLGQEGLHGVFDATDGLNTEALAVLAGVLRAGSWLLLL
FT                   VPAWDDWALLPDSDSLRWSEQSTPISTPNFIHHMQRQLLASPDVFLWQQGQLPPVPQFA
FT                   ARPNWQPPDGTPTTEQQAVLQRLMQAQQGVWVLTAARGRGKSTLAGMLVAQWPGKCWVT
FT                   GPGKAATQVLSQRAGDRARFWAPDALLEYCQQHDVSDVDWLLIDEAAAIPTALLSALLA
FT                   YFPRALLTTTVQGYEGTGRGFLLKFCATLNDWNHLTLTNPIRWASHDPLEQIIDDIMLF
FT                   NDDLPPTASAIAQIEISGCEQQDWLNNPELLCRFYGLLSCAHYRTTPLDLRRLLDAPGM
FT                   HFSAAKVADSVIGALWLVDEGGLDSTLAHEVWAGKRRPKGSLVAQSLAAHSGQWQAPTL
FT                   LSRRISRVAVAPLWRQQGIARQMIAAEQARAQGEGLDFLSVSFGYTAELACFWHACGFQ
FT                   LVRMGSHKEASSGCYAAMAILPLSLAGQKLCGAARQQLERDWYWLQQWVGLETPVSLFP
FT                   PEQPDITLNDDDWRELAGFAFAFRPLEASLPALQRLLLQTDLPLPALRQYLQQGVSIAE
FT                   IVRSLGLAGRKALAAHWRQEAAEGFNQRVASVD"
FT   CDS             complement(12323..12499)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28168"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I9"
FT                   /protein_id="CBY28168.1"
FT                   /translation="MLKNTLLGYGLTNIDIIEVTTNEMSKKMEGNDQKIGELAYTLITI
FT                   SGSLRISERLDSD"
FT   CDS             complement(13110..13223)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28167"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I8"
FT                   /protein_id="CBY28167.1"
FT                   /translation="MQSITANTDLYSLLNIADKKELAQTFFRGKPISRCFF"
FT   CDS             13328..13963
FT                   /transl_table=11
FT                   /locus_tag="Y11_00151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28166"
FT                   /db_xref="GOA:E7B1I7"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I7"
FT                   /protein_id="CBY28166.1"
FT                   /translation="MSQKSIVVQQPENPEHLILLFHGVGDSAAGMAPVGSHFAQAFPQA
FT                   LVVSIDGPFSSSMGNGRQWFSVQGITEQDRQGRIDEVMPEFITTVRHWQQQSGLSAAQT
FT                   TLVGFSQGTIMSLEGVKAQPQLAGQVVGFSGRFATLPQQPIADVIIHLIHGEQDGVISV
FT                   EQAKAAANSVTALGCSVTLDLDANTGHGINQPMLARAITHLHQDLAGN"
FT   CDS             14065..14214
FT                   /transl_table=11
FT                   /locus_tag="Y11_00161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28165"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I6"
FT                   /protein_id="CBY28165.1"
FT                   /translation="MKNGLEIDAPVSVELMRAVIFAIKVMAVGAVFVPAMYGIARLILA
FT                   VRWW"
FT   CDS             14216..14665
FT                   /transl_table=11
FT                   /locus_tag="Y11_00171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28164"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I5"
FT                   /protein_id="CBY28164.1"
FT                   /translation="MSRFALGFVVMSVMGLIALGWTTDHYRSKYLESERLTSERQFTIE
FT                   EMTRHQQISAALDAKYTQELADAKSQIEALRADVAAGRRRLRLNAQCVSTASAQIGTAS
FT                   MDDATGPRLTDAAQRDYLRLRERIDIATKQITGLQEYVNKVCLAN"
FT   CDS             15067..15441
FT                   /transl_table=11
FT                   /locus_tag="Y11_00181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28163"
FT                   /db_xref="GOA:E7B1I4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I4"
FT                   /protein_id="CBY28163.1"
FT                   /translation="MQNVTLIGIDLGKHSFHVHCQDKHGNALLRKKFSRTQLIHFLGSC
FT                   QAATVVMEACSGAQFMARQIADLGHEPKLIYPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVKPRRQWPPCIGSGTR"
FT   CDS             15408..16058
FT                   /transl_table=11
FT                   /locus_tag="Y11_00191"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28162"
FT                   /db_xref="GOA:E7B1I3"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I3"
FT                   /protein_id="CBY28162.1"
FT                   /translation="MAALHRVRDSLIRQRVKTTNQMHAFLLEFSVSLPRGIAVIRRLSA
FT                   VLEENDFPPYLARVLSRLHRHYVYLCGEIDEVDKELKTHLAEDENAQRLLTIPGVGPVT
FT                   ASLLATRLGDGKNYASSRDFAASTGLVPRQYSTGGKTTLMGISKRGDKNLRRLLVQCAR
FT                   VFIQRLEHNPGRLAEWVRKQLANHHSNVVACALANKLARIAWAVTAHQAAFSQ"
FT   CDS             complement(16284..16409)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28161"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I2"
FT                   /protein_id="CBY28161.1"
FT                   /translation="MAFSEVTFVNGLGFKMRGESAVIYCHKIYGHPRFCNADFDL"
FT   CDS             16836..17036
FT                   /transl_table=11
FT                   /locus_tag="Y11_00211"
FT                   /product="ORF45"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28160"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I1"
FT                   /protein_id="CBY28160.1"
FT                   /translation="MSHLNKLDHIINTETKEISQYARKMARWGVGGRKQILLMARKRMI
FT                   YEIQMYLPGLGSNAGNYCDIQ"
FT   CDS             17409..17885
FT                   /transl_table=11
FT                   /locus_tag="Y11_00221"
FT                   /product="attachment invasion locus protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28159"
FT                   /db_xref="GOA:E7B1I0"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1I0"
FT                   /protein_id="CBY28159.1"
FT                   /translation="MYAASENSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWG
FT                   VIGSFAYTHQGYDFFYGSNKFGHGDLDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKSS
FT                   VFDGSVSTSKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSVKFGTWMLGAGYRF"
FT   CDS             18041..18856
FT                   /transl_table=11
FT                   /locus_tag="Y11_00231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28158"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H9"
FT                   /protein_id="CBY28158.1"
FT                   /translation="MVTLEELVPQHHLVRKVDAAIDFEFIRDAVAHLYCPDNGRPAVDP
FT                   VRLIKMMLPGGRVLYTDSTHLKASANPRKAKNIPQPVKASAYIDSLNAAIDEDRAAAGK
FT                   KPLTPATTAKMKDTKVSTTDPESGFMHRDNKPKGFFWLDHRTEDGKYGIITDTYTTPRN
FT                   VHDSQPYIARLERQLSRFKLNPIAVGLDTGYFTAPVCHMTEQIDIIAVMGYRWPNKGQN
FT                   VLQKNTSFTMINRMFINAHKGSNLSTKPQAGKAIGTITLHLKSVGNART"
FT   CDS             19071..19214
FT                   /transl_table=11
FT                   /locus_tag="Y11_00241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28157"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H8"
FT                   /protein_id="CBY28157.1"
FT                   /translation="MLVGGRSAKHQEDGAAGAILLFINGILCSWQGYKVVEDIQSIAER
FT                   SE"
FT   CDS             complement(19322..19513)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00251"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28156"
FT                   /db_xref="GOA:E7B1H7"
FT                   /db_xref="InterPro:IPR020910"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H7"
FT                   /protein_id="CBY28156.1"
FT                   /translation="MHWLADYWWVVLIILIGMILNGIKELRRLDHKKFLSNKPEIPPHR
FT                   DNNARWDDDDWPDKDKKK"
FT   CDS             complement(19548..20258)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00261"
FT                   /product="D,D-carboxypeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28155"
FT                   /db_xref="GOA:E7B1H6"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H6"
FT                   /protein_id="CBY28155.1"
FT                   /translation="MTMTANTLTPQMITGRSTEHLVVLTGNHRMQPQAVDAFLAMQRAA
FT                   KVAGFDLQPASTFRDFDRQLAIWNGKFRGERPVLDKDSQPIDISQLDAASRCEAILRWS
FT                   ALPGASRHHWGSDLDIYDPSLLPLEAKLQLEPWEYQLGGYFYPLTQWLDTHMAEFGFYR
FT                   PFSADTGGVAAEPWHLSYRPLATTAEHLLTPAILLEAWQSQDVAGSEWLTGHLPMIFSR
FT                   FITIPNRFQAATNT"
FT   CDS             complement(20255..21382)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00271"
FT                   /product="N-succinyl-L,L-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28154"
FT                   /db_xref="GOA:E7B1H5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H5"
FT                   /protein_id="CBY28154.1"
FT                   /translation="MICPVIDLAQQLIKRPSLSPNDAGCQEIMIQRLEAIGFTVEPMNF
FT                   GDTLNFWAWRGEGETLAFAGHTDVVPTGDESHWSSPPFEPTIRDGMLYGRGAADMKGSL
FT                   AAMVVAAERFVAAHPNHKGRLAFMITSDEEAKAINGTVKVVNALMARHERLDYCLVGEP
FT                   SSTDRVGDVVKNGRRGSITANLHIHGIQGHVAYPHLADNPVHRAIPALNELVATQWDEG
FT                   NEFFPATSMQIANLHAGTGSNNVIPGEFYVQFNFRFSTELTDSMIKQRVETLLERHQLD
FT                   YTLEWVLSGQPFLTARGALVDAVVNAVEHYAEITPQLLTTGGTSDGRFIALMGAQVVEL
FT                   GPVNATIHKVNECVHAADLQLLSRMYQKIMEQLIA"
FT   CDS             complement(21384..21806)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00281"
FT                   /product="A glutathione-dependent thiol reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28153"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H4"
FT                   /protein_id="CBY28153.1"
FT                   /translation="MSDNPATPLLCLYGIKNCDTIKKARRWLEEQNIAYQFHDYRADGL
FT                   SDEHLQGFIDKLGWEPLLNTRGTTWRKLPQAQRDAITDAQSAKLLMLEQPAIIKRPLLE
FT                   AANGELLLGFKIEIYQQFIQQHLQKVTHNQNAIEVQ"
FT   CDS             21830..21946
FT                   /transl_table=11
FT                   /locus_tag="Y11_00291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28152"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H3"
FT                   /protein_id="CBY28152.1"
FT                   /translation="MARLCRINTRLVTDMAAWFIHNAGKWGLNPDGYGVFSA"
FT   CDS             complement(21969..22442)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H2"
FT                   /protein_id="CBY28151.1"
FT                   /translation="MKHSIDSLKELGRYDDAVAMAQNLLHSDPDNAILLYKIASLYDVQ
FT                   GLELQAIPFYRAAIEHNLAGKELQEAYLGLGSTYRALGLYQESLNTFDAALVRFPQAKE
FT                   IILFRAMTLYNLGETKEAVAALLILLAETSNHQDISLYQKAIRQYATDLDRIG"
FT   CDS             complement(22902..24116)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28150"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H1"
FT                   /protein_id="CBY28150.1"
FT                   /translation="MELPYEREITLAEAKKRILAEFQDNAITPHIENMGLHIITTTCDI
FT                   YDQNNNLLSQGVGKGIDGAALTGAFYEAFEHYISTNHQKFGEMTLCKTNKLQHTLGGTD
FT                   FVRDVLQTQPNTKIACRHYSNITGDISIYYPAAFSTPDYADYPLEGDNFDYQVLRRYSS
FT                   NSGTAIGSSFQEAALHAANESIEREDLSQFLINYFYQDNKKALRLVNPDSLQEELHTLW
FT                   LNAQAEIADHITVLEISQSSSCRTFIAFGHKICQAVHLFGAGTSLSPYYAISRAITELI
FT                   QFHSIVTRFPYLIETQKHSLRRLAQWPKLQRSCKAYLPGLLTDRTLHSVDIPEDSPIAP
FT                   VIDQLLQVERELNMRGYQLLVNILYQSTSGCTVVNVLVPGFERFFLINSGNIVVPWMGY
FT                   QYQNS"
FT   CDS             complement(24554..27685)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00321"
FT                   /product="putative aminoglycoside efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28149"
FT                   /db_xref="GOA:E7B1H0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1H0"
FT                   /protein_id="CBY28149.1"
FT                   /translation="MANFFIDRPIFAWVLAIILCLTGALAISTLPVEQYPNLAPPNVRI
FT                   SASYPGASAQTLENTVTQVIEQSMTGLDNLLYMSSQSSNSGSASITLTFQAGTNPNEAM
FT                   QQVQNQLQSAIKKLPQDVQQQGVSVSKSGDNTLMMVAFVSTDGSMDKQDIADYVASNLQ
FT                   DPLSRIEGVGSIDAFGSQYAMRIWLDPNKLNNYQLTTQDIVTAIQSQNSQIAVGQLGGT
FT                   PSVDNQALNATINAQSQLQTPEQFREITLRVNQDGSLVTLGDVAKIEMGAEKYDYLSRF
FT                   NGQPASGMSIKLASGANELQTDELVKARIAELTPFFPHGLEAKIAYETTPFVKASIKDV
FT                   VKTLLEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAILSAFGFSINTLTMFAIV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLDPREATRKSMSQIQGALVGIALVLSAVFIPMAF
FT                   FGGTTGAIYRQFSITIVSAMVHSVLVALILTPALCATMLKPIKPGHHHAKRGFFGWFNR
FT                   MFDRNAHRYERGVAQVLHHSARYMLLYLLLLGGLALLFIKLPTSFLPLEDRGVFMAQVQ
FT                   LPVGSTQQQTLRVVEKVENYFLTAEKNNVLSVFSTVGSGPGGNGQNVARLFIRLSDWEQ
FT                   RKDSNDSSFAIIERATKVFNKIAEAKVSVSSPPAISGLGGSSGFDMELQDHGGLGHDKL
FT                   MAARDQLLQMASQDPALTRVRHNGLDDSPQLQIDIDQRKAQALGVSLDDINNTLKTAWG
FT                   STYVNDFVDRGRVKKVYVQSEATARMLPEDVNKWYVRNKNGGMVPFSAFSTTRWEYGSP
FT                   RLERYNGYSALEIVGEAAPGVSTGTAMDVMEGLVKQLPNGFGLEWTGMSYQERLSGSQA
FT                   PALYAISLLVVFLCLAALYESWSIPFSVMLVVPLGVIGAVAATWMRGLENDVYFQVGLL
FT                   TIIGLSAKNAILIVEFASELNNKGKDLVEATLEASRLRLRPILMTSLAFIFGVLPMAIS
FT                   QGAGSGSQHAVGTCVMGGMISATVLAIFFVPLFFVLVRRRFPGRPAHTKNSDTQ"
FT   CDS             27895..28173
FT                   /transl_table=11
FT                   /locus_tag="Y11_00331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28148"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G9"
FT                   /protein_id="CBY28148.1"
FT                   /translation="MELNPVFARRLYLCWLISRGESLNVPRLMELTGWPRRTLQDVLKA
FT                   LPGLGITMTFVQDGVRNNAGYYRLDSWGPLNKKWIDDNHNFILAAIE"
FT   CDS             complement(28212..28922)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00341"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28147"
FT                   /db_xref="GOA:E7B1G8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G8"
FT                   /protein_id="CBY28147.1"
FT                   /translation="MAKLMPPNNPRSTARHLMLSVTGTLLIMTKSHTIMIVDDHPLMRR
FT                   GIKQLLELDSNFDVVAEANCGSDAIIEAAKCQPDVILLDLNMKGMSGLDTLKALRNEGI
FT                   DARIIVLTVSDARSDVYAMIDAGADGYLLKDSEPEILLENIRLASKGENVFSDAVTQYL
FT                   SSRDEQVNPFSELTERELDVLQEVARGMSNKQVAFELHISEETVKVHIRNLLRKLNVRS
FT                   RVAATIMYLENKQY"
FT   CDS             29346..29849
FT                   /transl_table=11
FT                   /locus_tag="Y11_00351"
FT                   /product="ferredoxin-type protein NapF (periplasmic nitrate
FT                   reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28146"
FT                   /db_xref="GOA:E7B1G7"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G7"
FT                   /protein_id="CBY28146.1"
FT                   /translation="MTDLSRRKLLTGFWQAGKQQPSAIRPPWSVSESDFIAGCTRCQNC
FT                   VAACETGVLVAGSGGFPEIDFQRAECSFCQACVLACEVGVFTSTAQPAWSLKINISDRC
FT                   LPFHNIECRSCQDSCETRAIKFRPHLNGIAQPELDFPACTGCGACVPSCPVQAVTLTRS
FT                   EDGR"
FT   CDS             29839..30105
FT                   /transl_table=11
FT                   /locus_tag="Y11_00361"
FT                   /product="periplasmic nitrate reductase component NapD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28145"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G6"
FT                   /protein_id="CBY28145.1"
FT                   /translation="MDDKEWHVCGLVIQAKPARIAPLIDSLLAIPGTEIPTSDTALGKL
FT                   VVVMQAARSDVLLNYIESARNLDGVLAVSLVYHQQESQGEEMP"
FT   CDS             30102..32597
FT                   /transl_table=11
FT                   /locus_tag="Y11_00371"
FT                   /product="periplasmic nitrate reductase precursor"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28144"
FT                   /db_xref="GOA:E7B1G5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G5"
FT                   /protein_id="CBY28144.1"
FT                   /translation="MKLSRRDFMKANAAVAAAAAAGLTIPTVAKAVVGETTNAIKWDKA
FT                   PCRFCGTGCGVLVGTQNGRIVASQGDPDSPVNRGLNCVKGYFLPKIMYGKDRLTQPLLR
FT                   MKDGQYDKEGDFTPISWEKAFDIMELKFKNALKEKGPTAVGMFGSGQWTVWEGYAASKL
FT                   LKAGFRSNNLDPNARHCMASSVVGFMRTFGMDEPMGCYDDIEEADAFVLWGSNMAEMHP
FT                   ILWSRMTSRRLTNEHVRIAVLSTFEHRSFELADNPIVFTPQTDLVIMNYIANYIIQNNA
FT                   VDQGFLDRHVNFRRGATDIGYGLRPTHPLEKAAKNPGSDASEPMNFDDFKAFVAEYTLE
FT                   KTAKMSGVPEDQLESLAQLYADPKVKLVSYWTMGFNQHTRGVWANNMCYNLHLLTGKIS
FT                   KPGSGPFSLTGQPSACGTAREVGTFSHRLPADMVVTNEKHRQISETKWQLPAGTIPEKV
FT                   GLHAVAQDRALKDGTLNAYWVMCNNNMQAGPNINEERMPGWRDPRNFIVVSDPYPTISA
FT                   LAADLILPTAMWVEKEGAYGNAERRTQFWRQQVPAPGEAKSDLWQIVEFAKRFKVEEVW
FT                   PDELINKKPEYRGKTLYDVLFANNVVNKYPLSEIPADQLNDEARDFGFYIQKGLFEEYA
FT                   DFGRGHGHDLAPFDRYHQERGLRWPVVNGKETLWRYREGFDPFVPKGEDVRFYGKPDGK
FT                   AVIFALPYEPAAESPDQEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLD
FT                   AKARGLRRGDKVKVISRRGEVISLVETRGRNRPPQGLVYMPFFDAAQLVNNLTLDATDP
FT                   LSKETDFKKCAVKLARVVA"
FT   CDS             32668..33135
FT                   /transl_table=11
FT                   /locus_tag="Y11_00381"
FT                   /product="nitrate reductase cytochrome c550-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28143"
FT                   /db_xref="GOA:E7B1G4"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR027406"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G4"
FT                   /protein_id="CBY28143.1"
FT                   /translation="MNNTMFHAFNRRVISVISLLAVLLIAGVVNAASNVEMDLSQSPEV
FT                   SGTAEGKVKMPKQQQRMALNYVNQPPLIPHSVDGYQISKNTNRCLQCHGVEHYRTTGAP
FT                   RVSPTHFIDRDGKVSSEVSPRRYFCLQCHVPQTDAAPIVGNSFQPAPGFGQ"
FT   CDS             33163..33762
FT                   /transl_table=11
FT                   /locus_tag="Y11_00391"
FT                   /product="cytochrome c-type protein NapC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28142"
FT                   /db_xref="GOA:E7B1G3"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G3"
FT                   /protein_id="CBY28142.1"
FT                   /translation="MNETKKPGMIKRIWQWWRRPSRLALGTLLLIGFVSGIIFWGGFNT
FT                   GMEMANTEKFCISCHEMKDNVYQEYMGTIHYSNRSGVKTTCPDCHVPHEWGPKMLRKIK
FT                   ASKELYAKAFGLIDTPQKFEAHRLTMAENEWARMKANGSQECRNCHNFDNMDFTAQKTV
FT                   AAKMHSQAIEEGKTCIDCHKGIAHKLPDMKDVPTGF"
FT   CDS             33944..34519
FT                   /transl_table=11
FT                   /locus_tag="Y11_00401"
FT                   /product="GDP-mannose pyrophosphatase YffH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28141"
FT                   /db_xref="GOA:E7B1G2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G2"
FT                   /protein_id="CBY28141.1"
FT                   /translation="MSVKIENIRSELLSKNWFKLHKYTFDLIDDNGTSVQQIREVYDRG
FT                   NGATILLYNRPNGTVLLINQFRMPTYVNGNPDGMLLETCAGLLDNDSPEECIRREAMEE
FT                   TGYQIDSVQKLFEAYMSPGGVTEIIHFFAAEYHSDQKVTDDVGVEDEVIEVVELPFTEA
FT                   IAMIADGRIKDGKTIMLLQYAQIHGVLK"
FT   CDS             34740..37019
FT                   /transl_table=11
FT                   /locus_tag="Y11_00411"
FT                   /product="nadp-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28140"
FT                   /db_xref="GOA:E7B1G1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1G1"
FT                   /protein_id="CBY28140.1"
FT                   /translation="MDEQLKQSALDFHQYPTPGKIQVSPTKPLATQRDLALAYSPGVAA
FT                   PCLEIAANPLAAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFSGI
FT                   DVFDIEVDELDPDKLIDIIASLEPTFGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQ
FT                   HGTAIICTAAVLNGLRVVKKDISDVKLVVSGAGAASIACLNLLVALGLKHHNITVCDSK
FT                   GVIYKGREANMAETKAAYAIEDNGQRTLGDAMPGADIFLGCSGPGVLTQDMVKTMAPSP
FT                   LILALANPEPEILPPLAKAVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATTIN
FT                   EEMKLACVHAIADLALAEQSDVVASAYGEQDLSFGPEYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPITDFSAYIEKLTEFVYKTNLFMKPIFSQAKKEMKRVVLAEGEEERVLHA
FT                   TQELISQGLAYPILIGRPNVIETRLKKLGLQITAGKDFEVVNNESDPRFNEYWHEYYQI
FT                   MKRRGVSQEQARRAVIGNPTLIGSIMVHRGEADAMICGTIGTYHEHYDVVEKVFGFREG
FT                   AHVAGAMNALLLPTGNTFIADTYVNDDPTPEQLAEITLMAAETVRRFGIEPKVALLSHS
FT                   SFGTSDCPAARKMRRTLELVNQMAPELEIDGEMHGDAALVESIRHNLMPDSTLKGAANL
FT                   LIMPNMEAARISYNLLRVTTSEGVTVGPVLMGVAKPIHILTPIASVRRIVNMVALAVVE
FT                   AQTQPL"
FT   CDS             complement(37436..37846)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00421"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY25609"
FT                   /db_xref="GOA:E7AZF6"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7AZF6"
FT                   /protein_id="CBY25609.1"
FT                   /translation="MGKTQPACQRVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAWL
FT                   GLVPREFSSGGKQRLGRISKRGDRYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKA
FT                   YNVAVVAQANKTARILWSMLVHHTEYRTLSAV"
FT   CDS             complement(37810..38484)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00431"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY25610"
FT                   /db_xref="GOA:E7AZF7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E7AZF7"
FT                   /protein_id="CBY25610.1"
FT                   /translation="MLKLRRRSIHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKHNPPAS
FT                   GS"
FT   CDS             complement(39239..39631)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28137"
FT                   /db_xref="GOA:E7B1F8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F8"
FT                   /protein_id="CBY28137.1"
FT                   /translation="MKKFDYNLVKLLQCLIEFRSVTRTAEELDVAISTVRHGLARLRRE
FT                   FNDRIVVNTKEGLVPTTLAITLNSHFSSAANLIDNAIAAGKNSDSAQNSLTINQCQPIN
FT                   PTLVKLPNIPTVTVQRYGRDFYYQIC"
FT   CDS             complement(39743..40201)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28136"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F7"
FT                   /protein_id="CBY28136.1"
FT                   /translation="MQIWVDADACPNVIKEVLFRAADRTGMMVTLVANQPLKTPPSKFI
FT                   RTLQVASGFDVADNEIVQRVEKNDLVITADIPLAAEVIEKGGIALNPRGERYTPDTIRE
FT                   RLNMRDFMDTMRASGIQTGGPNTLNQRDRQQFANELDKWLQQAIKAQV"
FT   CDS             complement(40201..41142)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00461"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28135"
FT                   /db_xref="GOA:E7B1F6"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F6"
FT                   /protein_id="CBY28135.1"
FT                   /translation="MNLPDIDQIKTYLLDLQDKICAALAQADGSAKFTEENWVREEGGG
FT                   GRSRVMVKGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPNSPYL
FT                   PTSHANVRFFIAEKPDEDPVWWFGGGFDLTPFYGFEEDAIHWHQTAYNLCQPFGEQLYT
FT                   RYKKWCDDYFYIKHRNEARGIGGLFFDDLNSDDLNSPDFDTCFNFTQAVGDGFLDAYMP
FT                   IVARRKALCWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW
FT                   EYNYQPAADSAEAALYRDFLPVKDWLAAGEHH"
FT   CDS             41373..41798
FT                   /transl_table=11
FT                   /locus_tag="Y11_00471"
FT                   /product="acetyltransferase YpeA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28134"
FT                   /db_xref="GOA:E7B1F5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023072"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F5"
FT                   /protein_id="CBY28134.1"
FT                   /translation="MEIRVFQQSDFEEVILLWEHCDLLRPWNDPEMDIERKLNHDPELF
FT                   LVAEVSGAIVGSVMGGYDGHRGSAYYLGVHPDFRGRGFANALISRLEKKLIARGCPKLN
FT                   IMVREDNDAVIGMYEKLDYETQDSIMLGKRLIVDQEY"
FT   CDS             complement(41952..42365)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00481"
FT                   /product="protein ygiW precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28133"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F4"
FT                   /protein_id="CBY28133.1"
FT                   /translation="MKKLTLAATLVMLCSTPFLAQSASTAAQGGFDGPATTQTQPAAQG
FT                   GFSGPNTSNTTVDKVKTMRDDAHVTLQGNITERLGHDTYTFRDSTGTITVDIDSKRWKG
FT                   QTITPQDKVQIEGKVDKDWNSVEVDVKNITKIK"
FT   CDS             42749..43360
FT                   /transl_table=11
FT                   /locus_tag="Y11_00491"
FT                   /product="putative outer membrane lipoprotein YfeY"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28132"
FT                   /db_xref="InterPro:IPR010938"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F3"
FT                   /protein_id="CBY28132.1"
FT                   /translation="MNICPRLSGMRWLLLGAPLLLAGCSATSGFSWSSLSPLNWFGDSS
FT                   SMQVTDKGVGGITASTPLSENEIKEGLKGDYRLRSGMATNGSKLVSFYQAMKEDQIKLV
FT                   ISGQLKGTVERIDVMDKDIPSQWGVSIGTPFSQLYKKAFGVCRQGTGDDHAQIECAAPD
FT                   SQHVSYLFDGDWHGPEGLMPSDDALQSWKVSKIIWRAKGE"
FT   CDS             43536..44441
FT                   /transl_table=11
FT                   /locus_tag="Y11_00501"
FT                   /product="putative iron-dependent peroxidase, Dyp-type
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28131"
FT                   /db_xref="GOA:E7B1F2"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F2"
FT                   /protein_id="CBY28131.1"
FT                   /translation="MTQVQSGILLEHCRFAIFMEAKVQGEFDAIRQGCKKFCFALQELQ
FT                   QQFPNEHLGAVIAFGSDIWHDLSNGQGAKELKPFTALGKAPMIAPATQRDLLIHIQSLR
FT                   QDINFTLAQAAVAAFGDAIAVEEETHGFRWVEERDFTGFIDGTENPQGESRPEVAVIAD
FT                   GEEDAGGSYVLVQRYEHDLKKWQRIPEHKQEQIVGRTKHGSEELPSDQRPDTSHVSRVD
FT                   LKENGKGLKILRQSLPYGTASGKHGLYFIAYCARLHNIEQQLLSMFGSIDGKHDLLLGF
FT                   SKPVTGSYYFAPSLTKLLSL"
FT   CDS             complement(44860..45132)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00511"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY25959"
FT                   /db_xref="GOA:E7B0J0"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J0"
FT                   /protein_id="CBY25959.1"
FT                   /translation="MLPREFSSGGKQRLGRISKRGDRYFRYLLVHGARAVAAVIERHKD
FT                   NMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHHTEYRTLSAV"
FT   CDS             complement(45101..45892)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00521"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28129"
FT                   /db_xref="GOA:E7B1F0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1F0"
FT                   /protein_id="CBY28129.1"
FT                   /translation="MLKLRRRSIHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKTQPACQ
FT                   RVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAERVLKWR"
FT   CDS             complement(46069..46959)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00531"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28128"
FT                   /db_xref="GOA:E7B1E9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E9"
FT                   /protein_id="CBY28128.1"
FT                   /translation="MKKLTGLIAAPHTPFDEQGEVNYPVIDQIAEHLVNDGVKGVYVCG
FT                   TTGEGIHCSVEERKKIAERWVKAAQGKLSLTLHTGALSIKDAIDLSRHAETLDIFATSA
FT                   IGPCFFKPGNIDDLIAYCQAIAAAAPSKGFYYYHSGMSGVNLDMEQFLIKAESKIPNLS
FT                   GIKFNNADLYEFQRCLRVSGGKFDIPFGVDEHLPGGLAVGAIGAVGSTYNYAAPLFHKI
FT                   IADFNAGNQVAVQRGMDQVIALIRVLVEFGGVAAGKAAMQLHGIDAGNPRLPLRALTKE
FT                   QKQTVVNRMRDAIAI"
FT   CDS             complement(47042..47677)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00541"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28127"
FT                   /db_xref="GOA:E7B1E8"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E8"
FT                   /protein_id="CBY28127.1"
FT                   /translation="MDTPEIVAAMALAALAGGAVGLRVEGISNIEAVRWVTDAPIIGII
FT                   KRDLPDSEVRITPWLEDVDALCAAGADIIAFDVTCRPRPVSVEDLFQRVQATGCLAMAD
FT                   ASNIEDGLLAHRLGIDFIGTTLSGYTQTPVPTEPDLELVKQLSQAGCKVIAEGRYNSPA
FT                   LAAAAISAGAYAVTVGSAITRIEHICSWFCEAIQHAPQENEAAKLTSH"
FT   CDS             47799..47915
FT                   /transl_table=11
FT                   /locus_tag="Y11_00551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28126"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E7"
FT                   /protein_id="CBY28126.1"
FT                   /translation="MKFYSDMLDLLFAGCNGQPFINQVKKRLLWSVTPIFKK"
FT   CDS             47987..48895
FT                   /transl_table=11
FT                   /locus_tag="Y11_00561"
FT                   /product="N-acetylmannosamine kinase"
FT                   /EC_number="2.7.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28125"
FT                   /db_xref="GOA:E7B1E6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR023945"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E6"
FT                   /protein_id="CBY28125.1"
FT                   /translation="MGKVLALDIGGTKIAAAVVTESGMLVGRQQVATPRGGAAQLALAL
FT                   ETLITPYRHLVDFIAVASTGIISDGRLTALNPGNLGGLADFPLQECIQSIADLPCVLLN
FT                   DGQAAAWAEYQALSHDGDKLISINNEISINNMMFVTVSTGVGGGIVLNKKLLVGNYGLA
FT                   GHIGHTLADPHGLLCGCGRKGCVESVASGTAIGAETLGWKQPVTAAKVFELAQLGNVHA
FT                   ENIINRSATAIAQMLADMKMALDLEVVILGGSVGLAPGYLERVIGVQKTFPDIYRVPLQ
FT                   AAYHRQDSGLLGAALWAKESL"
FT   CDS             48929..49393
FT                   /transl_table=11
FT                   /locus_tag="Y11_00571"
FT                   /product="putative sugar isomerase involved in processing
FT                   of exogenous sialic acid"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28124"
FT                   /db_xref="GOA:E7B1E5"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E5"
FT                   /protein_id="CBY28124.1"
FT                   /translation="MISGSLTQTAFFSGLPERLQWVLAYLAKTPLAQLSCGRHEIDGEL
FT                   IFMNVMEFDTQLAENKKAEMHQTYADVQLLISGIEGIEYSVLTPTEHLEPYHADDDYQL
FT                   IAEIPDKSQLRMLPGMFAVFLPGEPHKPGCQIAGSGTIKKAVVKVHHSLL"
FT   CDS             49589..50467
FT                   /transl_table=11
FT                   /locus_tag="Y11_00581"
FT                   /product="sialic acid utilization regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28123"
FT                   /db_xref="GOA:E7B1E4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E4"
FT                   /protein_id="CBY28123.1"
FT                   /translation="MKTGAPRFKPGKILDALGAMQNSLTRSAQRIAAYILAEPAKVTQL
FT                   SIADLSALTQAGEATIIRFCRTLGYKGFQDFKMDLAIEVATRHNNENSLLDADVQEGDD
FT                   TLAIGNKLQSAINNVLSETLNLLSIESVEQVVKLLRPADRICIFGVGSSGITAEDAKGK
FT                   LMRIGLRVDAATNNHFMYMQASLMRPGDVAIGISHSGTSAETVHALKLAKQAGATTVAL
FT                   THNMGSTITELADYVLINGNRQGQLQGDSIGTKIAQLFVLDLIYALLVKADPAQAESIK
FT                   RKTTQAVSQNG"
FT   CDS             50694..50825
FT                   /transl_table=11
FT                   /locus_tag="Y11_00591"
FT                   /product="sialic acid transporter (permease) NanT"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28122"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E3"
FT                   /protein_id="CBY28122.1"
FT                   /translation="MWRKPFGSDRLSDAKQSVAMVYLPRGKQFLPVNLAGGGERATL"
FT   CDS             50822..52348
FT                   /transl_table=11
FT                   /locus_tag="Y11_00601"
FT                   /product="sialic acid transporter (permease) NanT"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28121"
FT                   /db_xref="GOA:E7B1E2"
FT                   /db_xref="InterPro:IPR004742"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E2"
FT                   /protein_id="CBY28121.1"
FT                   /translation="MSTSVQPQTDKPPRGDKPLRWYKQLTPAQWKAFIAAWIGYALDGF
FT                   DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIV
FT                   LFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISG
FT                   FSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEKAQSKHQQSK
FT                   QAKDRNMVDILYRSKLSYRNIALTLFAAAALYACFTGMVSTPVVVLLGILCAAVFIYFM
FT                   VQTSGDRWPTGVMLMVVVFCAFLYSWPIQALLPTYLKMDLGYDPHTVGNVLFFSGFGAA
FT                   VGCCVGGFLGDWLGTRKAYVTSLLISQLLIIPLFAIQGSSILFLGGLLFLQQMLGQGIA
FT                   GLLPKLLGGYFDTEQRAAGLGFTYNVGALGGALAPILGASIAQHLSLGTALGSLSFSLT
FT                   FVVILLIGFDMPSRVQRWVRPSGLRMVDAIDGKPFSGAIGPVGASVVTQK"
FT   CDS             52866..53894
FT                   /transl_table=11
FT                   /locus_tag="Y11_00611"
FT                   /product="sulfate and thiosulfate binding protein CysP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28120"
FT                   /db_xref="GOA:E7B1E1"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E1"
FT                   /protein_id="CBY28120.1"
FT                   /translation="MKQISIKKNGWPRVALFSALIFGSATASATELLNSSYDVSRELFT
FT                   ALNQGFEKQWEQQNPGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDRG
FT                   NLIPADWQARLPNNSSPFYSTMAFLVRKDNPKNIHSWDDLVREDVKLVFPNPKTSGNGR
FT                   YTYLAAWGATEQANGKDEDKTRDWMKRFLKNVVVFDTGGRGATTTFVERGLGDVLISFE
FT                   SEVNNIRKEYGSDKYEVIVPPVDILAEFPVAWVDKNVEKNGTEKAAKAYLNYLYSPPAQ
FT                   QVITSFNYRVYDKAAMEAAKSQFPDTKLFRVEEQFGRWPQVMSTHFATGGVLDKLLAEG
FT                   HQ"
FT   CDS             53894..54730
FT                   /transl_table=11
FT                   /locus_tag="Y11_00621"
FT                   /product="sulfate transport system permease protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28119"
FT                   /db_xref="GOA:E7B1E0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1E0"
FT                   /protein_id="CBY28119.1"
FT                   /translation="MLSASSKRVLPGFTLSLGSSLLYTCLILLLPLSALVMQVAQMSWA
FT                   QYWEVITNPQVVAAYKVTLLAAGVASVFNAVFGMLMAWILTRYQFPGRSLLDGLMDLPF
FT                   ALPTAVAGLTLATLFSTTGWYGAWLNDVFGIKVSFTWLGIAVAMAFTSLPFVVRTVQPV
FT                   LEELGPEYEEAAETLGASRWQSFRLVVMPELAPALLAGTALSFTRSLGEFGAVIFIAGN
FT                   IAWKTEVTSLMIFIRLQEFDYPAASAIASVILAVSLVLLFGINTLQSRFGRRIGGH"
FT   CDS             54730..55605
FT                   /transl_table=11
FT                   /locus_tag="Y11_00631"
FT                   /product="sulfate transport system permease protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28118"
FT                   /db_xref="GOA:E7B1D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D9"
FT                   /protein_id="CBY28118.1"
FT                   /translation="MADISEFNGVARPPINWGKWTLIAIGALFSFLLLVIPMVWIFITA
FT                   FSKGIEVVGQNLLDPDMLHAIWLTVLVALITVPVNLVFGVVLAWLVTRFVFPGRQLLMT
FT                   LIDIPFAVSPVVAGLMYLLFYGSNGVVGGWLDSHDIQLMFSWPGMVLVTIFVTCPFVVR
FT                   ELVPVMMSQGSQEDEAAVLLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVS
FT                   VVSGSIRGETYTLPLQVELLHQDYNTAGAFTAAALLTLMAIVTLFLKSGLQWRLARQVV
FT                   RLEQEQKHEH"
FT   CDS             55595..56686
FT                   /transl_table=11
FT                   /locus_tag="Y11_00641"
FT                   /product="sulfate and thiosulfate import ATP-binding
FT                   protein CysA"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28117"
FT                   /db_xref="GOA:E7B1D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D8"
FT                   /protein_id="CBY28117.1"
FT                   /translation="MSIEIDNISKYFGRTKVLNDITLDIPSGQMVALLGPSGSGKTTLL
FT                   RIIAGLENQNAGRLSFHGTDVSRLHARDRRVGFVFQHYALFRHMTVFDNIAFGLTVLPR
FT                   RERPNAAAIKQKVAQLLEMVQLGHLANRYPSQLSGGQKQRVALARALAVEPQILLLDEP
FT                   FGALDAQVRKELRRWLHQLHEELKFTSVFVTHDQEEAMEVADRVVVMSQGNIEQVGAPD
FT                   EVWRDPATRFVLEFLGEVNRLSGEIRGSQLFIGAHHWPLDLAPMHQGSVDLFLRPWEME
FT                   VSTQSSSRCPLPVQVLEVSPRGHFWQLTVQPIGWHQDPISVVLPEGNIETPLRGSRYYV
FT                   GGLNARLYSGDQLLQPIALAQSA"
FT   CDS             56906..57787
FT                   /transl_table=11
FT                   /locus_tag="Y11_00651"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28116"
FT                   /db_xref="GOA:E7B1D7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D7"
FT                   /protein_id="CBY28116.1"
FT                   /translation="MTTLEHCIGNTPLVKLQRLSQGLNAEIWVKLEGNNPAGSVKDRAA
FT                   LAMIQRAELRGEISLGDVLIEATSGNTGIALAMIAALKGYQLKLLMPENMSQERQAAMR
FT                   AYGAELILVSREQGMEGARDQALAMQAEGQGKVLDQFNNTDNPYAHFTGTGPEIWQQTA
FT                   GKVSHFVSSMGTTGTITGVSEYLKSQNPDVTIIGLQPAEGSSIPGIRRWPAAYMPGIFR
FT                   PELVDQVLDISQISAEQTMRRLATEEGIFCGVSSGGAVAGALRVATENPGAVIVAIICD
FT                   RGDRYLSTGVFE"
FT   CDS             complement(57854..59023)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00661"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28115"
FT                   /db_xref="GOA:E7B1D6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D6"
FT                   /protein_id="CBY28115.1"
FT                   /translation="MALLAMSAQRLRTLLTMLGIIIGIASVVSVVALGKGSQQQVLANI
FT                   NSMGTSTLEIFPGKDFGDMRSAAIHTLRATDADALAQQGYIHSVTPTVSTSTTLRYGNK
FT                   SVSGTVNGVGEQYFLVRGYTLAQGMAFNHTSVDNLMQEAVIDENTRDKLFPNGENPLGK
FT                   VILLGSLPCRVIGVAAKKQSGFGSDENLNVWIPYTTAMKRMLGQSYLKSITVRVNDDID
FT                   LANAEQGVTKLLTQRHGTQDFFVMNTDSIRQTIEKTTSTMTLLVSMIAVISLVVGGIGV
FT                   MNIMLVSVTERTKEIGVRMAVGARASDIMQQFLIEAVLVCLLGGCLGVVLSLAIGLLFS
FT                   QFSSSFSMVYSATSIITAFICSSLIGVIFGFFPAKRAAQMDPIRALERE"
FT   CDS             complement(59051..59836)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00671"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28114"
FT                   /db_xref="GOA:E7B1D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D5"
FT                   /protein_id="CBY28114.1"
FT                   /translation="MPNLNQSKILLQLDNVSRWFISGEERVRVLKNINLTVHSGEMVAI
FT                   VGASGSGKSTLMNILGCLDKPSSGEYLVAGRIPQHLDSNELAELRREHFGFIFQRYHLL
FT                   NDLSAQENVEIPAIYAGVNREERRLRAASLLSRLGLVDRLDYRPSQLSGGQQQRVSIAR
FT                   ALMNGGEVILADEPTGALDTHSGTEVLNILKGLHQQGHTVVIVTHDMSIAEHAQRIIAL
FT                   RDGEVISDRQMPQPELPAKISTIETPDIAHKPPLTSWKA"
FT   CDS             complement(59840..61015)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00681"
FT                   /product="macrolide-specific efflux protein MacA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28113"
FT                   /db_xref="GOA:E7B1D4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D4"
FT                   /protein_id="CBY28113.1"
FT                   /translation="MGLVVVLLIAGGVLLFRLISPPDRPGFITAPAEIRTLEQTVLADG
FT                   TIKAQKQVTVGAQVSGQIKALHVTLGQQVEKGQLVAEIDDLTQQNALKDAEEALKNVLA
FT                   QRAAKEATQKNNQLTYQRQQQILAKGLGVRADFDSAKATLESTQAEIKALDAQIAQAEI
FT                   AVSTAKLNLGYTKITSPINGTVVAIPVEEGQTVNAVQSAPTIIKVAQLDTMTVEAQISE
FT                   ADVVKVKAGMPVYFTILGEPEERFSATLRAIEPAPDSINDKTTTTSSSSSSSSSSTTTA
FT                   IYYNGLFDVANPNGALRISMTAQVYIVLHKAEDAVVIPATALENNNGRYRVQAVDSNGK
FT                   VSTREVTVGLNNNVDAQILFGLQAGEQVIVSQASAVTSNNKAQHMGPPMGM"
FT   CDS             61237..61467
FT                   /transl_table=11
FT                   /locus_tag="Y11_00691"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28112"
FT                   /db_xref="GOA:E7B1D3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D3"
FT                   /protein_id="CBY28112.1"
FT                   /translation="MKILLVDDDVELGSMLREYLSGEGFTAELVLTGKEGIDGALSGNY
FT                   TALILDIMLPDMSGIDVLRQVRKKAAYRSSC"
FT   CDS             61461..61919
FT                   /transl_table=11
FT                   /locus_tag="Y11_00701"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28111"
FT                   /db_xref="GOA:E7B1D2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D2"
FT                   /protein_id="CBY28111.1"
FT                   /translation="MLTAKGDNIDRVIGLEMGADDYMPKPCYPRELVARLRAVLRRFDE
FT                   HPDVSSGDDGVITHGDLTLNPSTRSSEWQGKPFDLTASEFNLLELLLRSPDRVVTKDEL
FT                   SDKGLGRPREAYDRSVDVHISNIRQKLAALPGSTLNIETVRSIGYRIR"
FT   CDS             61945..63312
FT                   /transl_table=11
FT                   /locus_tag="Y11_00711"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28110"
FT                   /db_xref="GOA:E7B1D1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D1"
FT                   /protein_id="CBY28110.1"
FT                   /translation="MRGRLFWKILLGFWVTFILMTQMLWLVFSFYGNRHEPPEREMVRR
FT                   IAKLQVAYAASVLQRGGLPALNAMTANWSETDKSHFSVLPVAQITPVTALSSDKVQPPK
FT                   GRDPEFYSREVTTWTQSLDGQNYRISYDIDGLRDVNQRGEGGESRREILNIPIPMIWMG
FT                   VLGGLFFSTLLAWNLTRPMRQLRAGFERVAQGDLSVRLLPVMRQRHDELTEVARDFDSM
FT                   AERLEELVSAREQLLHDVSHELRSPLARLQLAIGLARQNPDNVENSLQRIEHESERLDK
FT                   MIGELLALSRAENHNIAEDDEYFDLRELVTVVVNDARYEAQVPGVEILLQVSPSDDYTV
FT                   KGNAELMRRAIDNIVRNALRFSTHGQQVKVLLSQVDKSYQIQVSDQGPGVDESKLSSIF
FT                   DPFVRVKSAMSGKGYGLGLAITRKVILAHGGQVEARNGEQGGLVITLRVPRWIAAD"
FT   CDS             complement(63364..63873)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00721"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28109"
FT                   /db_xref="GOA:E7B1D0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1D0"
FT                   /protein_id="CBY28109.1"
FT                   /translation="MGLFDKLKSLVSDDKKDSGTIEIVAPLSGEIVNIEDVPDVVFAEK
FT                   IVGDGIAIKPSGNKMVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGF
FT                   KRIAEEGQRVKKGDVVIEFNLALLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETP
FT                   IIRIKK"
FT   CDS             complement(63922..65649)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00731"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase of
FT                   PTS system"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28108"
FT                   /db_xref="GOA:E7B1C9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C9"
FT                   /protein_id="CBY28108.1"
FT                   /translation="MISGIAVSPGIAFGKALLLKEDEIVINRKKISADHVEQEVERFLA
FT                   GRAKASAQLETIKTQAGKTFGEEKEAIFEGHIMLLEDEELEQEIIALIKDDKQSADAAA
FT                   FSVIEGQAKALEELDDEYLKERAADVRDIGKRLLRNILGLEIVDLTTIQDEVILVATDL
FT                   TPSETAQINLNKVLGFITDLGGRTSHTSIMARSLELPAIVGTSKATTQIKNDDYVILDA
FT                   VNNKIYLNPTAEVIDQLKAVKEQYITERNDLAKLKDLPAITLDGHQVEVVANIGTVRDI
FT                   AGAERNGAEGVGLYRTEFLFMDRDSLPTEEEQFQAYKAVAEAMGSQAVIVRTMDIGGDK
FT                   DLPYMNLPKEENPFLGWRAIRIAMDRKEILHAQLRAILRASKFGKLRIMFPMIISVEEV
FT                   RELKAELELLKSQLREENKAFDETIEVGVMVETPAAAVIARHLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNELISHLYNPMSPSVLGLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISIPRIKKIIRNTNFEDVKVLAEQALAQPTAKELMDLVTTFIEEKTLC"
FT   CDS             complement(65697..65954)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00741"
FT                   /product="phosphocarrier protein of PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28107"
FT                   /db_xref="GOA:E7B1C8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C8"
FT                   /protein_id="CBY28107.1"
FT                   /translation="MFQQEVTITAPNGLHTRPAAQFVKEAKGFPCEITVTSNGKSASAK
FT                   SLFKLQTLGLTQGTVVTISAEGEDEKKAVEHLVKLMAELE"
FT   CDS             complement(66406..67374)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00751"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28106"
FT                   /db_xref="GOA:E7B1C7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C7"
FT                   /protein_id="CBY28106.1"
FT                   /translation="MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRI
FT                   GANMIWDAENRGILTADKELVEPTSGNTGIALAFVAAARGYKLTLTMPETMSIERRKLL
FT                   KALGANLVLTEGAKGMKGAIAKAEEIQATDPNRYIILQQFSNPANPEIHEKTTGPEIWE
FT                   DTDGEVDVFIAGVGTGGTLTGVSRYIKKTKGKSITTVAVEPTDSPVITQALAGQEIKPG
FT                   PHKIQGIGAGFIPGNLDLSLVDRVALVTNDEAISMARRLMDEEGILAGISSGAAVAAAV
FT                   KLSEEPDFTDKTIVVILPSSGERYLSTALFADLFTEQELQQ"
FT   CDS             complement(67564..68331)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00761"
FT                   /product="sulfate transporter, CysZ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28105"
FT                   /db_xref="GOA:E7B1C6"
FT                   /db_xref="InterPro:IPR022985"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C6"
FT                   /protein_id="CBY28105.1"
FT                   /translation="MAYTQKAVKKVSGIHYFAQGWQLISRPGIRRFVILPLLVNILLMG
FT                   GAFWWLFNRIGGWVPQLMSYVPDWLQWLSYLLWPVMVISVLLVFSYLFSTLANFIAAPF
FT                   NGLLAEQLEASLTGKPLPDTGILGIMKDLPRIMAREWRKLAYYLPRALVLLLLYLVPGV
FT                   GQTLAPVLWFLFSAWMLSIQYCDYPFDNHKVSFQHMRSALRQDKVDNLQFGALVSLFTM
FT                   IPLLNLVIMPVAVCGATAMWVDRYRDQFMQPPR"
FT   CDS             68551..69534
FT                   /transl_table=11
FT                   /locus_tag="Y11_00771"
FT                   /product="cell division protein ZipA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28104"
FT                   /db_xref="GOA:E7B1C5"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C5"
FT                   /protein_id="CBY28104.1"
FT                   /translation="MMQDLRLILIVVGAIAIIALLLHGLWTSRKERSSLFRDRPVKRPK
FT                   QERVETPIESLDEGVGEVRVRTAHPQEKPSFNHIDEDDDELPVIQHTETKPVQVKAEPR
FT                   QKPFASVPTDYEDPLLGGLSAEQPPHESQRDPLLGSVEEHDPQPRYAEPQHVAEHAPRV
FT                   APQHVESQPEPAVAAPEVKPQKLKETVLVLHVAAHHGGALGGEVLLQSVLQSGFQFGEM
FT                   GIFHRHLSLAGSGPVLFSLANMVKPGSFDPDTMSDFSTPGVSMFMMVPSYGDANQNFKL
FT                   MLQSAQRIADDVGGVVLDDERRMMTPQKLETYKARIREVLDANATA"
FT   CDS             69610..71628
FT                   /transl_table=11
FT                   /locus_tag="Y11_00781"
FT                   /product="DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28103"
FT                   /db_xref="GOA:E7B1C4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C4"
FT                   /protein_id="CBY28103.1"
FT                   /translation="MESIIQQINQLRTSLRHHEHLYHVLDAPEIPDAEYDRLMQQLREL
FT                   EAQHPELITNDSPTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRLKR
FT                   ADPLTFCCELKLDGLAVSLLYEDGELVRAATRGDGTTGENITANVRTIRAIPLRLQGDN
FT                   IPRRVEVRGEVFMPLAGFEQLNNEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTF
FT                   FCYGVGLLEGGELPRSHIQRLMQFRAWGLPVSDRVKLCTGSEQVIAFYRQVEQDRGGLG
FT                   FDIDGVVIKVDSLDLQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPV
FT                   ARLEPVQVAGVIVSNATLHNADEIERLGLRIGDTVIVRRAGDVIPQVVGVVMDQRPQDA
FT                   KEITFPEHCPVCGSDIERVEGEAVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI
FT                   IEQLVEKQYVENPADLFTLTAGKLTGLDRMGPKSAQNLIVALEKAKQTTFARFLYALGI
FT                   REVGEATAANLAAHFRNLENLRAADIEALKSVPDVGEVVAKHVVNFLGEEHNQKVIEAL
FT                   EKVITWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKDRLAALGAKVSGSVSKKT
FT                   DLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLGESS"
FT   CDS             71643..71858
FT                   /transl_table=11
FT                   /locus_tag="Y11_00791"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28102"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C3"
FT                   /protein_id="CBY28102.1"
FT                   /translation="MEKENLVEIANTRMPFGKYQGRVLIDLPEEYLLWFARKGEFPQGK
FT                   LGMLMEMTLTIKIEGLDGLVKPLKRG"
FT   CDS             complement(71934..72275)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00801"
FT                   /product="putative exported protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28101"
FT                   /db_xref="InterPro:IPR025577"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C2"
FT                   /protein_id="CBY28101.1"
FT                   /translation="MSNTISTASVSVSSSSSSDSSTAAQIKSLNQEIQKLTEKLSTLKD
FT                   SGLTADELQKQQQQIQSQIAALQAQVARIEAQAAEKAKEGEDNTTSASTPTGDGVNRPS
FT                   AQNQIDVYI"
FT   CDS             complement(72432..72992)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28100"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C1"
FT                   /protein_id="CBY28100.1"
FT                   /translation="MNQQQQIIEWLRADPYRMQALSIARELQLNQWCLAAGFVRNLVWD
FT                   KLHGYPSSTPLNDIDLVYFDEQDASEQHDLQLEEQLNHTTSALNQSFPWSVKNQARMHL
FT                   RNGRWPYTSTQDAISYWVEVETAIGACLKENGDIELVAPFGLAALFSQTITLNTQNGEI
FT                   DTYHQRVNSKGWQQHWPQLQLVV"
FT   tRNA            complement(73101..73176)
FT                   /locus_tag="Y11_t29310"
FT                   /product="tRNA-Ala-GGC"
FT   CDS             73216..73344
FT                   /transl_table=11
FT                   /locus_tag="Y11_00821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28099"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1C0"
FT                   /protein_id="CBY28099.1"
FT                   /translation="MKPLKQCQRLILFLTLSAEKAAKSVSKQHKKGDFTQSPDKCI"
FT   CDS             complement(73347..74762)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00831"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28098"
FT                   /db_xref="GOA:E7B1B9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B9"
FT                   /protein_id="CBY28098.1"
FT                   /translation="MKIKTRFAPSPTGYLHVGGARTALYSWLFTRHFGGEFVLRIEDTD
FT                   LERSTQEAIDAIMDGMNWLNLDWDEGPYFQTKRFDRYNAVIDQMLENGTAYRCYCSKER
FT                   LDELRETQMANGEKPRYDGRCRDSQCTHGADEPSVVRFRNPQEGSVIFNDKIRGPIEFS
FT                   NQELDDLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALGAPVP
FT                   EYAHVSMILGDDGKKLSKRHGAVGVMQYRDDGYLPEALLNYLVRLGWSHGDQEIFSVAE
FT                   MTELFTLDVVSKSASAFNTEKLQWLNHHYINSLPPEQVAVHLSWQVEQLGIDTRNGPEL
FT                   LEIVKLLGERCKTLKEMAESCRYFYEEFDEFDADAAKKHLRPVARQPLEAVKAKLAAIT
FT                   EWTTENVHNAIQGTADELGVGMGKVGMPLRVAVTGAGQSPGMDVTVHAIGQARSLSRID
FT                   KALAFISEREAQQ"
FT   tRNA            75024..75099
FT                   /locus_tag="Y11_t29280"
FT                   /product="tRNA-Val-TAC"
FT   tRNA            75153..75228
FT                   /locus_tag="Y11_t29270"
FT                   /product="tRNA-Val-TAC"
FT   tRNA            75268..75343
FT                   /locus_tag="Y11_t29260"
FT                   /product="tRNA-Val-TAC"
FT   tRNA            75370..75445
FT                   /locus_tag="Y11_t29250"
FT                   /product="tRNA-Lys-TTT"
FT   CDS             complement(75633..76712)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00841"
FT                   /product="nucleoside permease NupC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28097"
FT                   /db_xref="GOA:E7B1B8"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B8"
FT                   /protein_id="CBY28097.1"
FT                   /translation="MLVIEVLLAYFFLHSEVGLGFVKGFAGLFDKLLGFAATGTDFVFG
FT                   NMGDKGLAFFFLRVLCPIVFISALIGILQYIKVLPIVIRIIGTLLSKVNGMGKLESFNA
FT                   VSSLILGQSENFIAYKDILGKMSEKRMYTMAATAMSTVSMSIVGAYMSMLDAKFVVAAL
FT                   VLNMFSTFIVLSLINPYKAEDEEELQLSNLHEGQSFFEMLGEYILAGFKVAIIVAAMLI
FT                   GFIALIAAMNALFSLLFGISFQGILGYVFFPFAWVMGIPAHEALQVGGIMATKLVSNEF
FT                   VAMMDLQKVASELSPRSVGILSVFLVSFANFSSIGIVAGAIKGLNEHQGNVVSRFGLKL
FT                   LYGSTLVSVLSASIAGLVL"
FT   CDS             77216..78445
FT                   /transl_table=11
FT                   /locus_tag="Y11_00851"
FT                   /product="manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28096"
FT                   /db_xref="GOA:E7B1B7"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B7"
FT                   /protein_id="CBY28096.1"
FT                   /translation="MLNSRVVDTPPRTSRRIKLSLMGPAFIAAIGYIDPGNFATNIQAG
FT                   ASFGYTLLWVVVWANFMAMLIQLLSAKLGIATGKNLAEHIRDRFPRPAVWAYWVQAEII
FT                   AMATDLAEFIGAAIGFKLLLGVTLLEGAVLTGIATFLILMLQKRGQKPLELVIGGLLLF
FT                   VAAAYIVELVFSRPEIAALGRGMLIPDLPNRDAVFLAAGVLGATIMPHVIYLHSSLTQT
FT                   AGENSKADRYASTKLDVAIAMTIAGFVNLAMMATAAAAFHFNGYGSIAEIEQAYLTLQP
FT                   LLGNAAATIFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFYIPIWVRRTVTMLPSFIVIL
FT                   MGMDATRILVMSQVLLSFGIALALVPLLAFTGNKELMGDMVNSKLIQIFGKLIVLVVIG
FT                   LNAYLLVSLI"
FT   CDS             complement(78496..78915)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00861"
FT                   /product="putative exported protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28095"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B6"
FT                   /protein_id="CBY28095.1"
FT                   /translation="MLKMAMFKSTMLKLSVVRPRRIKPLLLITILAWFPLIPMANAESI
FT                   ELLPGVSLQIGEQDRSGNYWDGYDWRDQQWWQNHQGRYLGERNRHGHYWDGHRWQHKDW
FT                   WKKNYYYRDGHYWKYDKHHKKQSKKHHRGKGHDHN"
FT   CDS             complement(79086..80075)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00871"
FT                   /product="putative ion-channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28094"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B5"
FT                   /protein_id="CBY28094.1"
FT                   /translation="MVYQAASSRYQEMEYHRCGRSGLMLPAISLGLWHNFGDSTLYENS
FT                   RNLIHRAFDHGITHFDLANNYGPPPGSAELNFGRILQQDLRPYRDELIISSKAGYTMWP
FT                   GPYGDWGSKKYLVASINQSLQRMGLDYVDIFYHHRPDPNTPLEETMAALDLLVRQGKAL
FT                   YVGLSNYPAAQTRQACEILAQLGTPCLIHQPKYSMFERWIEADLQDTLDEYGVGSIAFS
FT                   PLAGGLLTDRYLAGIPLDSRAASDSKFLNPEQLSAEKLAKVRQLNELALDRGQKLSQMS
FT                   LAWVLRGGRVTSALIGASKISQIDDAMGMLANTEFSDAEIKVIENILV"
FT   CDS             80202..80315
FT                   /transl_table=11
FT                   /locus_tag="Y11_00881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28093"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B4"
FT                   /protein_id="CBY28093.1"
FT                   /translation="MCELINNLKKNIRFIDDLLNTYSTIISIKVGSDGKQL"
FT   CDS             80299..81960
FT                   /transl_table=11
FT                   /locus_tag="Y11_00891"
FT                   /product="pyruvate decarboxylase; Alpha-keto-acid
FT                   decarboxylase"
FT                   /EC_number="4.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28092"
FT                   /db_xref="GOA:E7B1B3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B3"
FT                   /protein_id="CBY28092.1"
FT                   /translation="MASNYKVADYLLDRLAQVGIRHLFGVPGDFNLHFLDHVISHPVIQ
FT                   WMGCANELNAAYAADGYARVMPAAALLTTTGVGELSAINGIAGSFAEYLPIIHIVGTPA
FT                   LRSQKAGELLHHSFGDGDFNHFARMAKEVACAHTSLTAENAASEIDRLLVAALYQRRPV
FT                   YLQLPSDVGEAELTSQSGVLALSQPMLSPTSLQAFIEAARQKLQSAHRVALLADFLADR
FT                   FGARQALNHWLAEVNLPHSTLLMGKGLLDETHPMFIGTYAGAASDASVREYIEEADVLI
FT                   TVGVWFVDTITAGFSQHITQDNCIDVQPEQVRIGRQVFSQIPMLAAVNALHELCLSLQS
FT                   EWQQPVIAHSMPALPCDNLLSQQAFWYHIQHFLRPDDIVVTDQGTSSFGAATLRLPSGC
FT                   TFVAQSLWGSIGFSLPAAYGAQLAQPQRRVILLVGDGAAQLTIQELGSMLRDGLTPIIF
FT                   LLNNHGYTVERAIHGPQQPYNDIAEWDWTQLPQALSVDKASLTCRVTQADELQQVLTQI
FT                   ENCQQLAFIEVMLPPMDMPELMINVAKSIQARNAAV"
FT   CDS             complement(81932..82819)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00901"
FT                   /product="DNA binding protein HpkR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28091"
FT                   /db_xref="GOA:E7B1B2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B2"
FT                   /protein_id="CBY28091.1"
FT                   /translation="MHYSPEALIAFVEAAALGSFSAAARKLRKSQSTISTAIANLEADL
FT                   GLTLFDRQARQPVLTDHGRRVLAHVQEILAASERLDNLSIRLAGQVETRLTFVLSDTYQ
FT                   PTHHESLLRRFEQRYPDIEFECLIAEDDDVIDLLQLRRAHIGVVEVQQHYPPDIATCRL
FT                   AEQTEMAIFVQRHHPLAQLSQVHPEQLATTRQLCLNTYNRTERNQSQGLIWSAPSYLML
FT                   MEMAVQGFGWAILPHWMVEQYSDKKLVALPIAGWPKTISIDAVWSKKSPPGPAGYWLLD
FT                   QLTGAIKPPHYGPE"
FT   CDS             82921..83397
FT                   /transl_table=11
FT                   /locus_tag="Y11_00911"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28090"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B1"
FT                   /protein_id="CBY28090.1"
FT                   /translation="MQVQRKTIFERIIHAIGFEVIAVAICAPVGAWLLDRSVLQMGTLA
FT                   ILLSSVAMLWNIIYNSLFDYFWPVSRVAKTLRVRAFHALGFESGFILIGLPIAAGVLGV
FT                   SLLQALMLEIGFFLFFLPYTMFYNWAYDSLRARIIRSRQANALTPAADKGRGSN"
FT   CDS             83583..84554
FT                   /transl_table=11
FT                   /locus_tag="Y11_00921"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28089"
FT                   /db_xref="GOA:E7B1B0"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1B0"
FT                   /protein_id="CBY28089.1"
FT                   /translation="MTSYALVGDVGGTNARLALCAVATGEISQAKTYSGLDYDSLEAVI
FT                   KQYLSEHKVTVEHACIAIACPITGDWVAMTNHTWAFSIAAMQQNLGLKHLEIINDFTAV
FT                   SMAIPMLSPQDVLQFGGTSPQPGKPVAVYGAGTGLGVAHLVNVDSRWISLPGEGGHVDF
FT                   APNSEEEDRILAVLRQELGHVSAERVLSGPGLVNLYRAIVISDGRLPENLVPKDVTERA
FT                   LADSCTDCRRALSLFCVIMGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRGAF
FT                   EDKGRFKDFLQDIPVYMITHQQPGLLGAGAYLRQKLGHRLHP"
FT   CDS             complement(84969..86018)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00931"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY25446"
FT                   /db_xref="GOA:E7AYZ3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7AYZ3"
FT                   /protein_id="CBY25446.1"
FT                   /translation="MLKLRRRSIHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKTQPACQ
FT                   RVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAWLGLVPREFSSGGKQRLGRISKRGD
FT                   RYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHH
FT                   TEYRTLSAV"
FT   CDS             complement(86186..87430)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00941"
FT                   /product="oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28087"
FT                   /db_xref="GOA:E7B1A8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A8"
FT                   /protein_id="CBY28087.1"
FT                   /translation="MSSKPVNRWLIVVGTIIVQMGLGTIYTWSLFNQPLGEKFSWSLGA
FT                   VATTFSITSFSLAIATLFAGRLQERIGIRKLTLISGIILGLGLIASSFATSLGMIYLLA
FT                   GIVVGFADGTAYITTLSNLIKWFPERKGLISGISVGAFGTGSLLFKYVNASLIANQGVS
FT                   LAFFYWGIIVMVLVGAGSFLLREKAVAPQTAAQLPSALVGRDFSVKEMLAVKESYFLFI
FT                   IFFTACMSGLYLIGIVKDLGVQLAGMDLATAANTVSAIAIFNTAGRIILGALSDKVGRL
FT                   RVISFTLLVTTLAVSVLSFVPLTHALFFLCVGAIAFCFGGNITVFPAIVGDFFGLKNHS
FT                   KNYGVIYQGFGLGALAGSFIAAQLGGYHATFIVIAVMSVVSLLLTLVIKPPKEAATEAE
FT                   NTSTAPAGVTANSHA"
FT   CDS             complement(87654..88394)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00951"
FT                   /product="hypothetical response regulatory protein ypdB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28086"
FT                   /db_xref="GOA:E7B1A7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A7"
FT                   /protein_id="CBY28086.1"
FT                   /translation="MKAIIVEDEFLAQEELSYLIQQHSNITIEATFEDGLDVLKYLQNH
FT                   QVDAIFLDINIPSLDGVLLAQNISKFAHKPYIIFITAYKEHAVEAFEIEAFDYILKPYH
FT                   ESRIVTMLQKLETLYKRDRQNKEQTNSPSHRPTPHTINLMKDERIIVTDINDIYYAAAQ
FT                   EKVTLVYTRREEFIMPMNITEFCSRLPEEYFFRCHRSYCVNLAKIREIVPWFNNTYILR
FT                   LSDLDFEVPVSRSKIKEFRQLMRH"
FT   CDS             complement(88398..90098)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00961"
FT                   /product="putative sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28085"
FT                   /db_xref="GOA:E7B1A6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A6"
FT                   /protein_id="CBY28085.1"
FT                   /translation="MHQIFEMLLAVFDRAALMLICLFFLTRTHLFRQLLQKEKHTPLEL
FT                   AAVTAIFSLFAIFGTYSGINVEGSLVNVRVIAVMSGGILFGPWVGIITGLIAGSHRYLI
FT                   DIDGITSVPCLITSIIAGLMSGYINLKVKKERQWSIGILAGMICESLTMLLVVIWAKPT
FT                   ALGIDIVSKIAIPMILGAVCIGLIVLLVQSVEDEKEVIAARQAKLALDIANKTLPYFRN
FT                   INGESLRSVCEIIRHDIKADAVAITDTQHILAYVSVGVETYNIGHEIISDITKESIQRG
FT                   KITIRNNDEVHRTPQIHSLIIIPLWEKGEVTGSLKIYYCHAHKITYSLKVMAVGLSQII
FT                   STQIEVSRIEQLRKMANKAEMRALQSKINPHFLFNALNAISSSIRINPDTARQLIINLS
FT                   RYLRYNLELNDEQIDIRKELHQIQDYIAIEQARFGSKLTVIYDIDDDIALKIPSLLIQP
FT                   LVENAIVHGIQPFRGKGVVVIAVKDCGDQIKISVKDTGNGINQETIERVANNEMPGNKI
FT                   GLLNVHHRVKLLYGEGLQIRRMEPGTEISFYISKNGGKVHAEPSISAGA"
FT   CDS             complement(90269..91558)
FT                   /transl_table=11
FT                   /locus_tag="Y11_00971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28084"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A5"
FT                   /protein_id="CBY28084.1"
FT                   /translation="MTLASTYSYWRINIMSSLQIDDIPSAIKAVKQQLRQALPNYQQVF
FT                   QEVEENIRQQVSEIRRSLVQGENPVPRIHADDIINGKVTDEQKAQIKQRGCCAILGVFP
FT                   TEKAAAWNREIGDYLDRNNFVERLKNAAEDNYFGTLAASKPQIYGIYWSTPQVEARQDQ
FT                   RMNAVQVFLNNLWQTESNGKQHFDPNRVVTYADRTRRRPPKSSSLGLSPHVDGGSIERW
FT                   LDENFRHVYRHVFSGEWQKYDPFAAEGRPEVREFASPAVCSMFRTFQGWTALTPQRTHA
FT                   GTLNVIPIANAMAYILLRALQDDVADDDLCGAAPGRALSASEQWHPLLIEAISPIPDLE
FT                   AGDTVFWHCDVIHSVENEHNGEFDSNVMYIAAAPWCEKNAAYLPHQLASFIDGRSPPDF
FT                   AADDFEVDFVGRATVDNLTAIGKQQLGMTK"
FT   CDS             91775..92290
FT                   /transl_table=11
FT                   /locus_tag="Y11_00981"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28083"
FT                   /db_xref="GOA:E7B1A4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A4"
FT                   /protein_id="CBY28083.1"
FT                   /translation="MLDSLVEQDWPLFLQLHQDPDVQRYIADPQGMAEIRARFESRLMP
FT                   WEKTANHWLCLVIRERESGQAIGLTGFLAEWLPLQQAEVGYAILPSYHGKGFAKESLMA
FT                   VLEFGFQQCQFHKMKATVTVGNTASRWTLESCGFQLEGTLRDNFQLDGQWCDDWVLGLL
FT                   DSEFELSH"
FT   CDS             92422..93657
FT                   /transl_table=11
FT                   /locus_tag="Y11_00991"
FT                   /product="uncharacterized PLP-dependent aminotransferase
FT                   YfdZ"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_00991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28082"
FT                   /db_xref="GOA:E7B1A3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A3"
FT                   /protein_id="CBY28082.1"
FT                   /translation="MAESPSKRRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGN
FT                   PDGPTPPHIVEKMCSVAQREDTHGYSTSRGIPRLRRAISRWYADRYQVDIDPESEAIVT
FT                   IGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLTEGIDFFGELER
FT                   AIRETIPKPKMMILGFPSNPTAQCVELDFFERVVALAKQYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVNALARIKSYHDYGTFTPL
FT                   QVAAIAALEGDQQCVRDIAEQYRQRRNALVRGLHEAGWMVENPKASMYVWAKIPEPYAH
FT                   LGSLEFAKRLLSDAKVCVSPGIGFGDYGDTHVRFALIENQDRIRQAVRGIKSMFRADGL
FT                   LKPGKSTPSERA"
FT   CDS             93826..94350
FT                   /transl_table=11
FT                   /locus_tag="Y11_01001"
FT                   /product="putative cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28081"
FT                   /db_xref="GOA:E7B1A2"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A2"
FT                   /protein_id="CBY28081.1"
FT                   /translation="MRNRYSLPQITLHWLTLLMVILTYAAMLLSDTVPDEDRTLVKNLH
FT                   FNFGISVWLLMLVRLWLRHKNTIPPITPRLPDWQLLGAHILHWCLYLMFLSLPILGVLA
FT                   QAYGGKTWFLLGWQVPQWVIPNDEARVYLKQVHELIANLGYFVIGAHALAALYHHYIRR
FT                   DDTLRRMMPGK"
FT   CDS             complement(94766..95197)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28080"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A1"
FT                   /protein_id="CBY28080.1"
FT                   /translation="MYHYPASYTYDEASGEYHIHYRDFPESGSVTYSVDDIELEAQDGI
FT                   KNGIAAQIEEQRPIPAPSAMQPDDIAIHVPILVRLKAELHNAMLTTQTRKADMARKLGL
FT                   NAAQMDRLLDVYYASKVEALEQALYLLGFEADVAVRKIG"
FT   CDS             95712..95882
FT                   /transl_table=11
FT                   /locus_tag="Y11_01021"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28079"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1A0"
FT                   /protein_id="CBY28079.1"
FT                   /translation="MKFMMKKIFLATTLITTVLLSGCATESSRSLEVAKVASYGTQYNG
FT                   PRSPQYGKDGI"
FT   CDS             96176..96706
FT                   /transl_table=11
FT                   /locus_tag="Y11_01031"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28078"
FT                   /db_xref="InterPro:IPR014591"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:E7B199"
FT                   /protein_id="CBY28078.1"
FT                   /translation="MLNMRNCFERNNLFGEKNVHAVFEVSLLLKAILAIMEIVAGILTF
FT                   FVTPQLLLNILHRITQVEFIEDRGDVIAHYLLHAAQSLSISSLHFAAFYLLIHGIVKLW
FT                   VIIGLWRKKLGYYPAAVVIFSLFIIYQLYRYTFTHSIMLILITILDLVVIVLTVLEYRQ
FT                   LRQEQKRLQAKPL"
FT   CDS             complement(96732..97370)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01041"
FT                   /product="rhtc-like transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28077"
FT                   /db_xref="GOA:E7B198"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:E7B198"
FT                   /protein_id="CBY28077.1"
FT                   /translation="MDEIHVIILTIGLFVLTFINPGANLLVVVQTSLSSGKNAGLLTGL
FT                   GVALGDAIYSGLGLFGMAALIAEGGTLFSAIKIGGGLYLVWYAYNMVRHRQELHMGMGA
FT                   VATSSITPWYVFFRRGLLTDLSNPQTVLFFISIFSVTLTPTTPAWAKMVAWLGIVVASI
FT                   LWRSLLSMAFSRPAVRRAYGKVQHLLSGIIGVAVGAFGLHLIYEGITRR"
FT   CDS             complement(97479..98528)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01051"
FT                   /product="ferric iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28076"
FT                   /db_xref="GOA:E7B197"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B197"
FT                   /protein_id="CBY28076.1"
FT                   /translation="MSTLELQQIGKSYQSVRVLEGIDLQVTAGSRTAIVGPSGSGKTTL
FT                   LRIIAGFETPDSGRVILQGNPLFDQSTHVPAHKRGIGFVPQDGALFPHFTVAGNIAYGL
FT                   KGSKQDKARRIDELMEMVALDRRLAQLWPHEISGGQQQRVALARALAQSPVLMLLDEPF
FT                   SALDTALRASTRKAVAELLSQANIASILVTHDQSEALSFADQVAVMRAGKLAHVGAPQE
FT                   LYLRPIDEPTATFLGETLILSANIDTGWADCALGRVKVDDATRQGQARIMLRPEQVTIT
FT                   PLPSAHHYPTHCLAKVVSIDFAGFISMLTLSIIEHNEIVSIKTISREGIHVGLMVDLTI
FT                   MGQAHIFVE"
FT   CDS             complement(98525..100081)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01061"
FT                   /product="ferric iron ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28075"
FT                   /db_xref="GOA:E7B196"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7B196"
FT                   /protein_id="CBY28075.1"
FT                   /translation="MPLSQTTQRQYSRRPGSGIVVIAVMLSLLSLLPLGFVIGIAIDTG
FT                   WSTVKALVFRPRVGELLLNTALLVAFTLPLCAIIGVALAWLTERTTLPGRRIWSLLAIA
FT                   PLAVPAFVQSYAWISLVPSMHGLSAGVFISVIAYFPFIYLPASAVLRRLDPGLEDAAAS
FT                   LGSTPSAVFFHVVLPQLKLAVWGGSILIALHLLAEYGLYAMIRFDTFTTAIFDQFQSTF
FT                   NGPAANMLAGVLALCCLGLLLIEATSRGYNRYARVGSGSARRQTAYSMGTALTLLCLLL
FT                   PLVMTTLSLGVPFITLTRWLYIGGIDVWLNAELFPALKQTLALALSGAVIITLCAIPMA
FT                   WLSVRYPGRLHRVMEGCNYVTSSLPGIVVALALVTITIRITRPLYQTEFTLLLAYLLMF
FT                   TPRALISLRAGIATAPVELENVARSLGKTPTQAIWSTTMRLAAPGAAAGAALVFLAISN
FT                   ELTATLLLAPNGTRTLATGFWALTSEIDYVAASPYALLIVALSLPLTWLLYSQSQRTAG
FT                   L"
FT   CDS             complement(100198..101214)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01071"
FT                   /product="ferric iron ABC transporter, iron-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28074"
FT                   /db_xref="GOA:E7B195"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B195"
FT                   /protein_id="CBY28074.1"
FT                   /translation="MKLRLSSLGPVALLASSMMLAFSANAASNDEGIVVYNAQHENLVK
FT                   SWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAP
FT                   LDAATQAQVAKEYRPEHGRWTGIAARSTVFVYNPEKISETELPKSIMDLAKPEWKGRWA
FT                   ASPSGADFQAIVSAMLELKGEKATLEWLKAMKTNFTAYKGNSTVMKAVNAGQIDGGVIY
FT                   HYYRFVDQAKTGENSGKTQLHYFKHQDPGAFVSISGGGVLASSKHPKEAQEFVKWITGK
FT                   SGQDILRTNNAFEYAVGVDAASNPKLVPLKDLDAPKVEPSKLNSKKVVELMTEAGLL"
FT   CDS             101526..102602
FT                   /transl_table=11
FT                   /locus_tag="Y11_01081"
FT                   /product="membrane-bound lytic murein transglycosylase B
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28073"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B194"
FT                   /protein_id="CBY28073.1"
FT                   /translation="MRHLAVILPSLILLSACSSKPTPPVAATPSDSLTQSGFLLEPQHV
FT                   GHVPDGDFAYNADTARFVDKMVREHGFERQQLHDVLAQTKKLDFVIRLMDKQAPTSGRP
FT                   SGPNGAWNRYRNKFITPDNVQNGVNFWNQHEKALQRAYEVYGVPPEIIVGIIGVETRWG
FT                   RVMGKTRIIDALATLSFAYPRRAEYFSGELETFLLMARAEGNDPLSLRGSYAGAMGYGQ
FT                   FMPSSFKDYAVDFNGNGHINLWDPEDAIGSVANYFKAHGWTKGAAVAIPANGQAPNLDN
FT                   GFKTKYPISTLSAVGLSPTGSLGDYQEASLLRLDVGTGYQYWYGLPNFYTITRYNHSTH
FT                   YAMAVWQLGEAVGRARRG"
FT   CDS             complement(102823..104166)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01091"
FT                   /product="putrescine importer"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28072"
FT                   /db_xref="GOA:E7B193"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E7B193"
FT                   /protein_id="CBY28072.1"
FT                   /translation="MPQNIQLRRVLKTPALVAFGLAYMVPLGVFTTYGQVTVLSQGHLP
FT                   IAYLVTVATILFTALSYCRMTNAMPLSGSAYSYVQRSFGGKTGFLVGWAQILDYLFLPI
FT                   LNYLVLGIFLHEAFPAIPAPVFIIASIVSVSLLNILGVRLLTSVNFSLIAAQMVFIVLF
FT                   IALSFSQADLSPAALMKPLLVNAGDMSGLLSGAAVLCLAFLGFDAIATMAEEAHDAKRT
FT                   LPRAILFTVISAGAIFIAVSYAAHLAYPDWKSLIPYQDTASLIISEHVGGKWMYNFFMA
FT                   TYLTGVYASAMTAQTSVSRIFYAMGREGVLPRKVFFHLHRKFHTPWRAILFVATISLLA
FT                   LFLDLNLVVSMISFGALGAFTFVNLSVIKHFIFNEKRCGVSAMFKYGLLPMMGFVMSVW
FT                   LWVHLEQRALEVGLLWLLAGFIYLLWLTRGWRQSPPSVHPDDISHLMD"
FT   CDS             complement(104482..106212)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01101"
FT                   /product="exoenzymes regulatory protein aepA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28071"
FT                   /db_xref="GOA:E7B192"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniProtKB/TrEMBL:E7B192"
FT                   /protein_id="CBY28071.1"
FT                   /translation="MTQQSTVADVIYYNGIIYTADANNQVCSTIALGQGYILATGNDEL
FT                   IPQFSGPKTQLIDLAGKFMMPGLIDSHMHPFWGGKQLIGCNLNYAALSVEQTLDIIQKH
FT                   LDSDPFKGENDWLTVRAWQRQAMTPVGADMSRAALDSLNTRRPVALFSNDCHTLAANSR
FT                   ALELLGIDENTPVPPDGKIARDANGKLTGILEDAPAMRAFDSIPSATPEKNVQIAAHVQ
FT                   QVLNAQGVTTVMDTRVFAEQLVAFRQLYERNELTLRVLGAKEVTPDSLQGPEDAARVVQ
FT                   EVVEFGRLWGNEEWTPAPGFAVDHLKLFIDGVLQPPTMTAALLEPYRANHGTAENPDWQ
FT                   PTKHYGDLYFTAPVVNAVILECARAGLHPHTHTVGDGAIEMVLDAVEQMRAAFPGKDIR
FT                   PGLAHNELVAAHQYDRFAKLGATAVLSFQWGGLPGVLIDEEREMLGEARFQHMEPAARF
FT                   LDAGARIAYGSDWPIDRLDEWYNLQVGMTRRAWHLDGSPAGPRLDNDRDLTLIETLRSA
FT                   TIDAAYMIAKEQYIGSLEASKFADIIILNNNLFEQPPETICQTQVESTLIGGKVVYQAG
FT                   "
FT   CDS             complement(106372..106989)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01111"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28070"
FT                   /db_xref="GOA:E7B191"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:E7B191"
FT                   /protein_id="CBY28070.1"
FT                   /translation="MNASDKGVSLAYLNREERHDTILRAAMRVAITEGMNATTVRRVAS
FT                   EAGVAVGQVHHHFTSVSRLRADAFLLLVKQSLAAFAINSQNLPAHERVLLVLGYPQDEA
FT                   GKRETRLWNEVSVMAERDDLIKEACAISMSDWHQATVEVIDAGIANNEFRSDIRASDIA
FT                   WRLIGLVCGLDGLTQLTELGFSETEILRHLTATMKAELLKNP"
FT   CDS             107111..108634
FT                   /transl_table=11
FT                   /locus_tag="Y11_01121"
FT                   /product="methyl viologen resistance protein smvA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28069"
FT                   /db_xref="GOA:E7B190"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B190"
FT                   /protein_id="CBY28069.1"
FT                   /translation="MIFYVIILMYLPVSIDATVLHVAAPRLGIALSATGSELLWIIDIY
FT                   SLVMACLLLPMGALGDRIGFKRLALLGSVLFGMASLGAALAPSVAALIAARACLAIGAA
FT                   MILPATLSAVRHIFTDERERALALGIWVAIGTMGAAMGPLVGGLLMEYFYWGSVFLINI
FT                   PIIIAVVIATLAVIPTQPMRTEQTWKLAPALVLITAILMLVYAAKTGLRGNGDPVTTSL
FT                   TALFGGVMLFVFVRHQLSTSAPMIDFRLISQRVIAVGITMAMTAMITLVGFELLLTQEL
FT                   QFVLGKSPLEAGIFLLPLMIASGVSGPLSGWLVARLGLRTVASAGIAFSSLSFLGLAWT
FT                   DFATQVYLAWGWMILLGFSIEASLLASTAAIMSAAPPEKAGAAGAVEGMAYELGAGLGV
FT                   AIFGLMLSRAYTSSIVLPEDLPASLTEQASASISETIQVVNNLGGYDALLNSAKLAFSA
FT                   SHSLVLGTASGLLILLATVVWFAMPGKKYGNLHIDRRGQLAPQTADKVD"
FT   CDS             109027..110091
FT                   /transl_table=11
FT                   /locus_tag="Y11_01131"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, permease component USSDB6A"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28068"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="UniProtKB/TrEMBL:E7B189"
FT                   /protein_id="CBY28068.1"
FT                   /translation="MLAHYRVLEPVVTQFRASQPQSVVFDLTQLGALDTAGATLLALLL
FT                   GDERINHLRELAPKLPEERRTLLETVSRVLPDLASESSEKPPSFWLEFLANTGRSVDNL
FT                   WQDIKSLLGFVGLTLEVLFSTIFRPSRWRMTSLIANIQQIGLNAVPIIMLLTFLVGAVI
FT                   AFLGATVLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEI
FT                   DAIQTLGLNPVELLVLPRVLALLISLPMLTFIGMICGIFGGMVVCALALDISPTMFLSI
FT                   MQNSNGLQHFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVIL
FT                   LDAVAALFFMEMGW"
FT   CDS             110085..110891
FT                   /transl_table=11
FT                   /locus_tag="Y11_01141"
FT                   /product="ABC transporter ATP-binding protein USSDB6B"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28067"
FT                   /db_xref="GOA:E7B188"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B188"
FT                   /protein_id="CBY28067.1"
FT                   /translation="MVSQMTQEPIIQIRNLVNCFGKQCVHQDLNLDVQRGEVLGVVGGS
FT                   GTGKSVLLRSIVGLRRPTAGQIHVFGQDLMTLSGQARSQVERRFGVLFQRGALFSSLTV
FT                   TENVALPLIENAGLPRGEAERLAQVKLALAGLPPGAGSKYPASLSGGMVKRVALARALA
FT                   LDPDILFLDEPTAGLDPIGAAAFDSLIRTLRDSLNLTVFLVTHDLDTLYTLCDRVAVLS
FT                   QKKVLVVDTLDKVAATDDDWIQAYFHGPRGRAAYQAAAAINSEERL"
FT   CDS             110892..111833
FT                   /transl_table=11
FT                   /locus_tag="Y11_01151"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, periplasmic component USSDB6C"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28066"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E7B187"
FT                   /protein_id="CBY28066.1"
FT                   /translation="METRAHHVVIGLFTLIVVSAALLFCLWLTNAGSNRQFKLYDIVFN
FT                   EPVSGLSQGSIVQYSGIRVGEVTQLRLDSENPNKVWARIRVSASTPIRQDTQARLTVAG
FT                   ITGTSNIQFSSSTPSSPLLEGKDGEIPIIIATPSPMSQLLANGENFMSNANEVLMRLNQ
FT                   LLAPDNQQRLITTLDNLALVTQTVADQRQDIRTMLQQLAQASKQANETLAQTNRLLRNA
FT                   NGLMDGQGKQLVNDAAKTMASLQNTSIILNKLVSENQTSLNNGMQGMNELGPAVDELRR
FT                   TLATLRAAVSRLEENPAALLRGRERTQEFTPR"
FT   CDS             111830..112465
FT                   /transl_table=11
FT                   /locus_tag="Y11_01161"
FT                   /product="membrane lipoprotein lipid attachment site
FT                   containing protein USSDB6D"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28065"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E7B186"
FT                   /protein_id="CBY28065.1"
FT                   /translation="MISLKIMHSTGRGTRLLMLSGLAMLLSACTILPSAPVSQVYLLPV
FT                   PPAANAPRAQAVNWSLRVSQPATNQFINSSRIAVQPEGQEIAVYKNSRWTDPAPILVRN
FT                   RLIQEFRTDGRIPAVSSDDDSLQADVELSGDLSAFQGVYQAGNSEVLIRFDARLVRISD
FT                   RRIMATRHFEVRQPIKGAQMNEVVDAFGLASNQLASQVLNWALQQSPQ"
FT   CDS             complement(112507..112689)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01171"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28064"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:E7B185"
FT                   /protein_id="CBY28064.1"
FT                   /translation="MCCAGSLENNVNVMKLKQYALDCGYRLTDDIIIENISGPVIEKKK
FT                   SDFLIKIMVAIQSDK"
FT   CDS             complement(112656..113147)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01181"
FT                   /product="putative exported protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28063"
FT                   /db_xref="GOA:E7B184"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7B184"
FT                   /protein_id="CBY28063.1"
FT                   /translation="MVNINYRLSPEAAWPAQINDIKAAIKFVRANAKKYNFDPDNIVLM
FT                   GGSAGGNLVALAGVSADVKSLEDPALGYPDISTKVQAVIAWYPPINFLKMDEQWKHIGI
FT                   DGQKHSTADSFESFLMRKQISQVPQDIFAITQPLFINHLIPCGRGSLSACVVPEVLRTT
FT                   "
FT   CDS             113540..114028
FT                   /transl_table=11
FT                   /locus_tag="Y11_01191"
FT                   /product="cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28062"
FT                   /db_xref="GOA:E7B183"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E7B183"
FT                   /protein_id="CBY28062.1"
FT                   /translation="MHCYALFALGLWMVTLGYYDGWYHQAPEIHKSIGCILFVVMLFRV
FT                   IWRFISPPPRPLSSYSRFTRLSAVLVHLFLYIVLFCIMFSGYLISTADGQPISVFGWFA
FT                   VPATLTSLPDQADTAGTVHLYLAWAVVVLSLLHGLAAIKHHFIDGDITLKRMLGRSTD"
FT   CDS             114054..114269
FT                   /transl_table=11
FT                   /locus_tag="Y11_01201"
FT                   /product="protein yceI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28061"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:E7B182"
FT                   /protein_id="CBY28061.1"
FT                   /translation="MFNKTLLGLTVGALMFTAGSAVAAEYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGSFNDFDGFLLLMKRIPQLIK"
FT   CDS             114266..114631
FT                   /transl_table=11
FT                   /locus_tag="Y11_01211"
FT                   /product="protein yceI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28060"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:E7B181"
FT                   /protein_id="CBY28060.1"
FT                   /translation="MNVVINTNSVDTNHAERDKHLRSKEFLNVGKFPQATFESTEVKKN
FT                   AEGYTVVGNLTLNGVTKPVTLESKLTGQGNDPWGGYRAGFEANGNIKLKDFNITTDLGP
FT                   ASQEVELILSVEGVRAK"
FT   CDS             complement(114698..115729)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01221"
FT                   /product="ascbf operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28059"
FT                   /db_xref="GOA:E7B180"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B180"
FT                   /protein_id="CBY28059.1"
FT                   /translation="MSTMQEVAKKAGVSKATVSRVLSGKGYVSDATKESVFKAIEETGY
FT                   RPNLLARNLATNKSECIGLVVTNTLYNGSYFNEILSQAAQKLEKNGRQLVLVDGKHSAE
FT                   EEQEAIQFLLDLRCDAIIIYPRFLTVDAMDLIIDQYKQPIMVVNRKLRKNHSHCIFCDH
FT                   KGSSYNATKYLIDQGHRDIAFITGSLDSPTAIERLSGYKAALAAFSLPVQDKLIAQGRW
FT                   TPASGATAAEFLLASQLPFSAIIASNDDMAIGAMKKLNEAGLKVPEDVSIIGFDNIPIA
FT                   PFLLPPLSSIKDPVSGMINEVINRLISMLDGGYLSNENIFQSELFIRDSVGKGPFFTEN
FT                   KVK"
FT   CDS             116073..117530
FT                   /transl_table=11
FT                   /locus_tag="Y11_01231"
FT                   /product="PTS system, arbutin-, cellobiose-, and
FT                   salicin-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28058"
FT                   /db_xref="GOA:E7B179"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:E7B179"
FT                   /protein_id="CBY28058.1"
FT                   /translation="MSKNYAAVSQQIVDAIGGVNNIGAVTHCMTRLRFVLNDMTVVDLA
FT                   KLKAITGVLGVVHSENQCQVIIGNNVSYAFAEVLKLLPEGALPANALPQKNKITLKRIG
FT                   AGILDALIGTMSPLIPAIIGGSMVKLLAMILDMTGIFEKGSSTLIILNVIGDGAFFFLP
FT                   VMVAASAAIKFKTNMSLAIAIAGVLVHPAFIDLMAKAAQGQHVEFMGVSVTAVKYTYTV
FT                   IPALCMTWLLSYIERWVDRITPAVTKNFLKPMLIVLISAPIAIMFIGPLGIWIGSGISS
FT                   LVYTVHDYLGWLSVAIMGALWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANL
FT                   SLGGSSLAVAWRTKNPELRQTALAAAASAIVAGISEPALYGVALRLKRPLIASLISGFI
FT                   CGAVAGIGGLASHSMASPGLFTSVQFFDPANPMSIVWVFGVMILAIVISFVTTLLLGFE
FT                   DIPVEDSADSRADSPASTVSHSAVKIN"
FT   CDS             117546..118976
FT                   /transl_table=11
FT                   /locus_tag="Y11_01241"
FT                   /product="6-phospho-beta-glucosidase ascB"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28057"
FT                   /db_xref="GOA:E7B178"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:E7B178"
FT                   /protein_id="CBY28057.1"
FT                   /translation="MSVSTFPDGFLWGGALAANQAEGACFESGKGLTTVDMIPHGEHRL
FT                   AVKLGREKRFTLRDDEFYPSHQAIDFYHRYKDDIALMAEMGFTVFRTSIAWSRIYPNGD
FT                   ELTPNAEGIAFYRDLFNECKKHNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVEFFTRYA
FT                   RTCFEAFDGLVKYWLTFNEINILLHSPFSGAGLVFEPNENQEQVKYQAAHHELLASALA
FT                   TKIAHEINPENQVGCMLAGGNFYPRTCKPEDVWAALEKDRENLFFIDVQARGAYPAYTK
FT                   RLFREKGISIATQVGDDDILKHTVDFVSFSYYASRCASADMNDHNSSAANIVKSLKNPH
FT                   IQASEWGWGIDPLGLRITMNMMYDRYQKPLFLVENGLGAKDEINPQGEIEDNYRISYLR
FT                   EHIKAMAEAIDDGIPVIGYTSWGCIDLVSASTGEMSKRYGFVYVDRDDLGKGSLARKKK
FT                   KSFYWYKKVIASNGADLS"
FT   CDS             complement(119069..119380)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28056"
FT                   /db_xref="InterPro:IPR024476"
FT                   /db_xref="UniProtKB/TrEMBL:E7B177"
FT                   /protein_id="CBY28056.1"
FT                   /translation="MSGYRYRITIEPLTDRKGEPLDKAPVTFEAENHDEILGIIERLQA
FT                   REDLDFGKEKTAAFALGLKLFSETMMENRKHPVFAPLRTAFMDFMTNLKKGSTRDRSE"
FT   CDS             complement(119380..120006)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01261"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28055"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B176"
FT                   /protein_id="CBY28055.1"
FT                   /translation="MFGFSKRGHRCGDRIYRGGRHHMAAEAIEAARGSRRGRGEKMHRL
FT                   FEHGDLRVVLLALLDKKPSHGYELIKAIEEASSGLYVPSPGVIYPTLTLLEEQDFVTPV
FT                   ATGNGRKSYQITDAGKAELQQNQQMVDAIFARLAQVNRRPEGNMAEGISDAMHRLRHIL
FT                   RSSMMRSDVTPEQVEHINAALLTAVEAIEKALEPKATETNEPEKS"
FT   CDS             complement(120271..120609)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01271"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28054"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:E7B175"
FT                   /protein_id="CBY28054.1"
FT                   /translation="MGLPNCPKCNSEYTWQEGEKLNCPECGNEWSENGDSATTDEGLVV
FT                   RDANGNLLADGDAVTVVKDLKVKGSSSTLKIGTKVKSIRLVEGDHNIDCKIDGFGPMKL
FT                   KSEFVKKS"
FT   CDS             complement(121177..121305)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28053"
FT                   /db_xref="UniProtKB/TrEMBL:E7B174"
FT                   /protein_id="CBY28053.1"
FT                   /translation="MLLTDIQIRRATAQDKAYTLNDGNGLSLLINPNGSEDKYDVQ"
FT   tRNA            complement(121459..121533)
FT                   /locus_tag="Y11_t28790"
FT                   /product="tRNA-Arg-CCT"
FT   CDS             complement(121706..122617)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01291"
FT                   /product="putative transport"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28052"
FT                   /db_xref="GOA:E7B173"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:E7B173"
FT                   /protein_id="CBY28052.1"
FT                   /translation="MSNEKRSQDKGELTVESDEPREEQEIEVNEKKLPSKAAAIHEIIR
FT                   VDGEKELERDSFALLWSAVAAGLSMGASLIAKGIFHAKLPETPASFLLENIGYTFGFII
FT                   VIMARQQLFTENTVTPVLPIMQKPSRQNFILLFRLWGLVLLGNLIGTGIAAYSFIHMPV
FT                   FDNATRAAFVTIAQGVMESSAGEMFAKGIFSGWIIATMVWMMPSAGGAKIWVIFLMTYL
FT                   VALCDLTHIVVGSVEIFYLVFNGSIPWQQFIYPFAIPTLAGNIIGGTFIFALISHAQIR
FT                   SDMAHQPKKSEKVDSDSPPPHS"
FT   CDS             123077..123703
FT                   /transl_table=11
FT                   /locus_tag="Y11_01301"
FT                   /product="ABC transporter involved in cytochrome c
FT                   biogenesis, ATPase component CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28051"
FT                   /db_xref="GOA:E7B172"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B172"
FT                   /protein_id="CBY28051.1"
FT                   /translation="MLEAKNLTCIRDERSLFQQLSFCVAAGEIVQIEGQNGAGKTSLLR
FT                   ILAGLADADEGQVNWLGENIRRDRSRYHQDLLFLGHQPGIKSVLTPFENLAFYQSVFQL
FT                   VDSAAIWQALSQVGLVGYEDLPVSQLSAGQQRRVALARLWLSQTPLWILDEPLTAIDKQ
FT                   GVSTLLALFVEHAAKGGMVLLTTHQELDGVGQQVRKIRLTNTQEN"
FT   CDS             123703..124362
FT                   /transl_table=11
FT                   /locus_tag="Y11_01311"
FT                   /product="ABC transporter involved in cytochrome c
FT                   biogenesis, CcmB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28050"
FT                   /db_xref="GOA:E7B171"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:E7B171"
FT                   /protein_id="CBY28050.1"
FT                   /translation="MFISVLRRELKIAFRKGAEIVNPLWFFLIVITLFPLGIGPEPQLL
FT                   ARIAPGIVWVAALLASLLSLERLFRDDFHDGSLEQLLLLPSPLTLTVLGKVCAHWVVTG
FT                   LPLLILSPLVGLLLSLDSNTAIAMALTLLLGTPTLSFIGAIGVALTVGLRKGGILLSLL
FT                   VLPLYIPVLIFATAAIDAASMSLPIDGYLAILGAMLAGSATLAPFATAAALRVSVH"
FT   CDS             complement(124428..124550)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28049"
FT                   /db_xref="UniProtKB/TrEMBL:E7B170"
FT                   /protein_id="CBY28049.1"
FT                   /translation="MKPFPHFSLLTLKLDGHHHMGNTGAGNGAQSALTGVGYRA"
FT   CDS             124533..125270
FT                   /transl_table=11
FT                   /locus_tag="Y11_01331"
FT                   /product="cytochrome c-type biogenesis protein
FT                   CcmC,putative heme lyase for CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28048"
FT                   /db_xref="GOA:E7B169"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:E7B169"
FT                   /protein_id="CBY28048.1"
FT                   /translation="MWKWFHQFAKPERLYQLCGQFIPWLGIGAVICLIVGWVWGFGFAP
FT                   SDYQQGNSFRIIYLHVPAAIWSMGIYMSMAIAAFVGLVWQMKMSDNVVAAMAPVGAVFT
FT                   FIALVTGSAWGKPMWGTWWIWDARLTSELVLLFLYLGVIALYNAFEDRKLAGRAAGILV
FT                   LVGVVNIPIIHFSVVWWNTLHQGSTNMQQSIDPSMRSPLRWAILGYLFFFITLTLMRLR
FT                   NLILQQERHRPWVAALLRKEPRV"
FT   CDS             125267..125515
FT                   /transl_table=11
FT                   /locus_tag="Y11_01341"
FT                   /product="cytochrome c-type biogenesis protein
FT                   CcmD,interacts with CcmCE"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28047"
FT                   /db_xref="GOA:E7B168"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:E7B168"
FT                   /protein_id="CBY28047.1"
FT                   /translation="MNPAFNSWAAFFAMGGYAFYVWLAIAATVLSLLGLWIHTAWQHKQ
FT                   LLADIQRREAREQRIRQANQAQNHPVKNAARSQEKQQ"
FT   CDS             125512..126006
FT                   /transl_table=11
FT                   /locus_tag="Y11_01351"
FT                   /product="cytochrome c-type biogenesis protein CcmE, heme
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28046"
FT                   /db_xref="GOA:E7B167"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E7B167"
FT                   /protein_id="CBY28046.1"
FT                   /translation="MNPRRKSRLYLAVVVLIGIGLTTTLVLYALRSNIDLFYTPGEILQ
FT                   GKGERHEKPEIGQRLRIGGMVMPGSVKRDDKTLEMSFKVYDARGAVTVTYTGILPDLFR
FT                   EGQGVVAQGVFAEGNTINAKEVLAKHDEKYTPPEVKEAMKENHTRPAEAYNSTAAQGNA
FT                   S"
FT   CDS             126003..127970
FT                   /transl_table=11
FT                   /locus_tag="Y11_01361"
FT                   /product="cytochrome c heme lyase subunit CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28045"
FT                   /db_xref="GOA:E7B166"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="UniProtKB/TrEMBL:E7B166"
FT                   /protein_id="CBY28045.1"
FT                   /translation="MMPEIGSFLLCLALAISLLLSLYPQWGAARQDARMMATGRPLTYG
FT                   MFATIALSFICLVYAFVVNDFTVSYVAANSNSHLPVYYRIAATWGAHEGSLLLWVLLLS
FT                   CWSLAVALFSRSMPDDAVARVLSVLGMITGGFLLFIILTSNPFNRTLPDFPIDGNDLNP
FT                   LLQDVGLIFHPPLLYMGYVGFSVAFAFAIASLMAGRLDSAWARWSRPWTQAAWVFLTMG
FT                   IVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALIHSLAVTEKRGTFKAWTVLLAI
FT                   TAFSLCLMGTFLVRSGVLVSVHSFASDPARGMFILAYLVIVIGGSLLLYAVKGAQVRSR
FT                   TQHEVFSRETFLLGNNVLLIAAMLVVLLGTLLPLVHKQLGLGSISIGEPFFNTMFTWLM
FT                   APMALLMGIGPLVRWRRDEPSKLYKRLGVALVVTLLMSILVPWLLQDTIAGMTVVGLMM
FT                   AIWVIILTVMELHERATHRHGFWRGLSHLSRSHWGMVLGHLGVAVTVIGIAFSQNYSVE
FT                   RDVRMKAGDSIDIHDYHFVFRDVHDVKGPNYTGGVGIIDVTRNGKPEATLHAEKRYYSV
FT                   ARSMMTEAAIDGGLTRDLYAALGEELDDGSWAVRLYYKPFVRWIWYGGVFMAIGGIFCM
FT                   FDPRYRMSKKLKRGAATEAK"
FT   CDS             127970..128536
FT                   /transl_table=11
FT                   /locus_tag="Y11_01371"
FT                   /product="cytochrome c-type biogenesis protein
FT                   CcmG/DsbE,thiol:disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28044"
FT                   /db_xref="GOA:E7B165"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:E7B165"
FT                   /protein_id="CBY28044.1"
FT                   /translation="MKSQSSFNKLMFIPLVLFLLLVVAFLVQLTRNANGDDPTMLESAL
FT                   IGKPVPAFKLESLEQPGKTFDQAVLHDGKPMLLNVWATWCPTCRAEHEYLNKLAAQGIR
FT                   VVGLNYKDDRAKAVQWLNSLGNPYALSLYDGDGMLGLDLGVYGAPETFLIDGQGIIRYR
FT                   HAGDLNDRVWQQEILPLYKKYQGGA"
FT   CDS             128533..129039
FT                   /transl_table=11
FT                   /locus_tag="Y11_01381"
FT                   /product="cytochrome c heme lyase subunit CcmL"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28043"
FT                   /db_xref="GOA:E7B164"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="UniProtKB/TrEMBL:E7B164"
FT                   /protein_id="CBY28043.1"
FT                   /translation="MRFFSLALGLILGWSIFATNVFAAIDTYTFSSVDQEQQYRELTEQ
FT                   LRCPKCQNNSIADSNATIAADMRGKVYELQQQGNSKQQIIDYMVARYGNFVTYEPPVTA
FT                   ATLILWVGPAMFVLIGAVIVVLRARRRVEKEAALSPQEQQRLDTLLAEQKQPSASHKKT
FT                   NRKQP"
FT   CDS             129039..130259
FT                   /transl_table=11
FT                   /locus_tag="Y11_01391"
FT                   /product="cytochrome c heme lyase subunit CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28042"
FT                   /db_xref="GOA:E7B163"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E7B163"
FT                   /protein_id="CBY28042.1"
FT                   /translation="MVFWLIVIILLAVAGALLVIPALRQESNSSVTTRDELNKAIYQDR
FT                   LSELAEDEAQGVVEQRPELIQELQQNLLTDIPHESTEDASPINRWVLLPGVVILVVVAV
FT                   GLYVKTGGLAQVQAWHQVEAQMPELRARVANERAEPLTMEEVARLGLGLRTSLQQDSGN
FT                   VNDWMMLGRVGMALNNATTATQAFAKAYQLAPDNDDVRLGYAEVLTRSNDPQDNQLATK
FT                   MLRTMVGQDHTNLRAMSLLAFNAFEQGDFKQAIGAWEVMLKLLPAGDSRVEVIKRSIAQ
FT                   AKSQAGQETATLGIEISLSPEAAQKLPQQGALIISVTDGTNPIPVAVKQLPLSRFPLSV
FT                   TLDDSNAMMPERLLSSLQQVKVRARISLDGTANSQPGDWFGESGVQDFGTKGQPQTIHV
FT                   QINKQIP"
FT   CDS             130284..131060
FT                   /transl_table=11
FT                   /locus_tag="Y11_01401"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28041"
FT                   /db_xref="GOA:E7B162"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:E7B162"
FT                   /protein_id="CBY28041.1"
FT                   /translation="MEKDMNYRLIGLVFATVLLIGCASSSPDQMEQGRSDPLEGFNRAM
FT                   FNFNYEVLDPYVVRPVAVVWRDYVPQPARNGMSNFLGNLEEPASMVNSFLVGDPYNAMK
FT                   HFNRFFLNTILGMGGLIDVAGMANPKLAKKVPNRFGSTLGHYNVGYGPYVVLPGYGSFT
FT                   IREDGGNAADYVYPVLSYLTFWMSAGKWMLDGVETRAQLLDSDGLLRNSSDPYLMVREA
FT                   YFQRNDFLANGGQLKPEANSNAQAIEGDLESIDSPN"
FT   CDS             complement(131153..132424)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01411"
FT                   /product="long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28040"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="UniProtKB/TrEMBL:E7B161"
FT                   /protein_id="CBY28040.1"
FT                   /translation="MNQKNLFTRSALAAAVAIISSNVSAAGFQLNEYSAAALGRSFSGE
FT                   GAVADNASVGSRNPAAMTLFDRPSFSGGFVYVDPNVDISGTSPSGRSTSAKNIAPSEWI
FT                   PNIHFIMPLNEQWAIGASGTSNYGLATEFNDDYTAGLLGGQTDLKTANLNLSGAYRLNE
FT                   NFSFGLGFNAVYADAKIVRHLGEAGARVGLPASTEATRMEGTKWGYGWNAGVLYEVDKE
FT                   NRYSFTYRSKVKIDFDGDFSNQLPRAVGGTGGAVVPGALTLNLPEVWEVSGYNKVAPQW
FT                   AIHYSMAYTSWSQFKELKATGTNGNTLFEKQEGFHDAYRIALGTTYYYDDNWTFRTGIA
FT                   FDDSPVPADNRTISIPDQDRFWISAGTTYAFNKDASVDVGISYMHGQNVHITEKTPTAL
FT                   GGTTYEFDSKGTALLYGVNFNYAF"
FT   CDS             132942..133166
FT                   /transl_table=11
FT                   /locus_tag="Y11_01421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28039"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="UniProtKB/TrEMBL:E7B160"
FT                   /protein_id="CBY28039.1"
FT                   /translation="MDNTDCTASYSCVFDNRVEAEVMLKTLTEKARAVESEPCLIEHKL
FT                   EETDGGVRLTVDFTFACQAETMIFQLGLR"
FT   CDS             133475..134785
FT                   /transl_table=11
FT                   /locus_tag="Y11_01431"
FT                   /product="3-ketoacyl-CoA thiolase @ Acetyl-CoA
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28038"
FT                   /db_xref="GOA:E7B159"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E7B159"
FT                   /protein_id="CBY28038.1"
FT                   /translation="MSKPLPLVTRQGDRIAIVSGLRTPFAKQATAYHGVPAVDLGKIVV
FT                   SELLARSGVAPELIDQLVFGQVVQMPEAPNIAREIVLGTCMSVRTDAYSVSRACATSFQ
FT                   AVANVAESIIAGSVTVAIAGGADSSSVLPIGVSKALARTLVDVNKARTLSQRLKLFSRL
FT                   KLRDLLPVAPAVAEYSTGLRMGDTAEQMAKTYGISRQDQDALALRSHQMAAQAWQQGLL
FT                   HDEVMTAYIPPFSDAITEDNNIRKDSTMDQYAKLRPAFDRKHGSVTAANSTPLTDGAAA
FT                   VMMMSESKAKALGLQPLGYLRSFAFSAIDVWQDMLLGPSYATPLALDRAGITLADLTLI
FT                   DMHEAFAAQTLANLKMFASDSFAREKLGRSQAISEVDMSKFNVLGGSIAYGHPFAATGA
FT                   RMITQTLNELRRRGGGLGLTTACAAGGLGAAMIVEVE"
FT   CDS             134785..137022
FT                   /transl_table=11
FT                   /locus_tag="Y11_01441"
FT                   /product="enoyl-CoA hydratase;
FT                   Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA
FT                   epimerase"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="5.1.2.3"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28037"
FT                   /db_xref="GOA:E7B158"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012802"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B158"
FT                   /protein_id="CBY28037.1"
FT                   /translation="MSQENTLNSGDETTQVEAVAPAHSVFTLKVRHDNIGIITVDVVGD
FT                   KVNTLKAEFAEQIAEILQQAQALSQLQGLVIISGKPDSFIAGADITMIAACHTAQDARI
FT                   LAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSQDDKTVLGLPEVQLG
FT                   LLPGSGGTQRLPRLVGVSKALDMILTGRQVRARQALKMGLVDDVVPQDILLDVAIQRAK
FT                   AGWLDKPALPWQERLLSGPLGKALLFNIVRKKTQAKTKGHYPATERIIDVVRKGLDHGG
FT                   PAGYEAEAKAFGELAMTPESAALRSLFFATTSLKKESGGKAQPRAFHRVGVLGGGLMGG
FT                   GIAHVTATRAGLPVRIKDINPTGINQALKYTWDTLGKRVRSKRMRPAERQRQMMLISGS
FT                   TDYCGFGNVDIVVEAVFEDLSLKQQMVADIEHFAAPHTIFASNTSSLPISDIAAQAQRP
FT                   EQVIGLHYFSPVDKMPLVEVIPHAKTSKETIATTVALACKQGKTAIVVADRAGFYVNRI
FT                   LAPYINEAARCLLDGEPIDSVDKALVDFGFPVGPITLLDEVGIDVGTKIIPILVEKLGA
FT                   RFAAPPSFDVILEDGRKGRKNGRGFYLYPAKNSGFKWKRSPGKQVDTSVYTLLGVTPKA
FT                   HLESAVIAQRCTMMLLNEAARCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYMDSLG
FT                   ADKVVKTLNLLAQQYGERFEPCPLLVTMAEQQKRFYPPENSLDEAAITAHN"
FT   CDS             137405..137896
FT                   /transl_table=11
FT                   /locus_tag="Y11_01451"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28036"
FT                   /db_xref="GOA:E7B157"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E7B157"
FT                   /protein_id="CBY28036.1"
FT                   /translation="MQVFIMRHGDAALDAASDAQRPLTLCGQDESRQIASWLNDQSVDV
FT                   DRVLVSPYLRAGQTLAVVREVLTLPAEQEVMPELTPGGDAAFVSCYLQALAKEDCAAVL
FT                   VISHLPLVGYLVAELCPGQCPPMFATSAIACVDLDDETGKGTFDWQVSPTQLLAKACHG
FT                   "
FT   CDS             complement(138198..138728)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28035"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="UniProtKB/TrEMBL:E7B156"
FT                   /protein_id="CBY28035.1"
FT                   /translation="MKNKYHLTTDELQLFKESIAGAKRLKQDTIVHRSPPKLGKKIAPE
FT                   RLLQEQVDASYYFSDEFQPQLDTEGPTRYVRPGVDHFEVKKLRRGDYSPDMFLDLHGLT
FT                   QKQAKQELGALIAACKREHVHCACVMHGHGKHVLKQQTPLWLAQHPDVLAFHQAPKEWG
FT                   GTAALLVLIELEQ"
FT   CDS             138935..139867
FT                   /transl_table=11
FT                   /locus_tag="Y11_01471"
FT                   /product="ribosomal protein L3 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28034"
FT                   /db_xref="GOA:E7B155"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7B155"
FT                   /protein_id="CBY28034.1"
FT                   /translation="MDKIFVDEAVNELHTIQDMLRWAVSRFNAANIFYGHGTDNPWDEA
FT                   VQLVFPSLFLPIDIPEDMRSARLTSSERHRIVERVIRRVNERIPVAYLTNKAWFCGMEY
FT                   YVDERVLVPRSPIGELINNNFSGLIRHQPKHILDMCTGSGCIAIACAYAFPEAEVDAVD
FT                   ISNDVLAVTEHNIQQHGMEHQVTPIRSDLFRDLPPIKYDLIVTNPPYVDAEDMADLPQE
FT                   FRFEPELGLAAGSDGLKLARRILACAPDFLQDDGVLICEVGNSMVHLMDEYPDVPFTWL
FT                   EFDNGGDGVFMLTKQQLIDCASHFSMYRD"
FT   CDS             139944..141029
FT                   /transl_table=11
FT                   /locus_tag="Y11_01481"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28033"
FT                   /db_xref="GOA:E7B154"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniProtKB/TrEMBL:E7B154"
FT                   /protein_id="CBY28033.1"
FT                   /translation="MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDL
FT                   DRRRPGTSRYTTQRREPDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRP
FT                   GHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQIGDI
FT                   SCDVVDWDQVEQNPFFCPDASKLESLDALMRELKKAGDSIGAKITVVAEHVPVGLGEPV
FT                   FDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGIS
FT                   SGQPVVAHIALKPTSSITVPGQTINRQGEAVEMITRGRHDPCVGIRAVPIAEAMMAIVL
FT                   MDHLLRQRAQCGDVVSDVPRW"
FT   CDS             141035..141862
FT                   /transl_table=11
FT                   /locus_tag="Y11_01491"
FT                   /product="murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28032"
FT                   /db_xref="GOA:E7B153"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B153"
FT                   /protein_id="CBY28032.1"
FT                   /translation="MKKWIAGLLALIAISPVMAATPWQQITHPVAGSPQAIGGFANGCV
FT                   IGAMPLPLESADYQVMRPDQRRYFGHPDLLNFIHRLSDKAQKNQLGTVLIGDMAMPAGG
FT                   RFSSGHASHQSGLDVDIWLQLPQQRWSQQQLLKPQPIDLVAADGKRVVPALWQPQVENL
FT                   IKLAANDNEVTRIFVNPAIKKQLCLDAGADRTWLHKVRPWFGHRAHMHVRLRCPADSLE
FT                   CLDQDTPPPGDGCGAELESWFKPHQPSAKPGKTLPPPLPPSCQALLDNHFAAE"
FT   CDS             141866..142672
FT                   /transl_table=11
FT                   /locus_tag="Y11_01501"
FT                   /product="putative membrane protein YfcA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28031"
FT                   /db_xref="GOA:E7B152"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E7B152"
FT                   /protein_id="CBY28031.1"
FT                   /translation="MDWFTLGPAVLGILFLVALLAGFIDSIAGGGGLLTVPALLAVGLP
FT                   PAQVLATNKLQSVGGSFSASLYFIRRGAVNLKEQKLTIALTVVGSMLGAILVQHMRADI
FT                   LRQILPLLVIGIGVYFLVTPKLGEVDQQRRLSALPFALIAGGGVGFYDGFFGPGAGSFY
FT                   ALAFVTLCGFNLAKSTAHAKVLNFTSNLGSLIFFIVGGKVVWSIGLVMLVGQVLGARLG
FT                   AHMVLTKGQKLIRPMIVVVSFVMSCKLLYDSHGAEITAWLGLHVFA"
FT   CDS             142979..143521
FT                   /transl_table=11
FT                   /locus_tag="Y11_01511"
FT                   /product="putative transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28030"
FT                   /db_xref="InterPro:IPR007411"
FT                   /db_xref="UniProtKB/TrEMBL:E7B151"
FT                   /protein_id="CBY28030.1"
FT                   /translation="MTHDYQQLIDIFNRCFSDEYNTQLVKGDDEPIYLPADEQFSYHRV
FT                   IFAHGYYASGMHEISHWCIAGEERRKLVDFGYWYYPDGRDALTQSQFEVVEIKPQALEW
FT                   MFCVAAGFPFNVSCDNLEGDCEPDRITFQRKVREQVLWHLENGISSRPAGFIQALQSFY
FT                   NTPPLVPALFPYPEDLA"
FT   CDS             143585..143866
FT                   /transl_table=11
FT                   /locus_tag="Y11_01521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28029"
FT                   /db_xref="InterPro:IPR014987"
FT                   /db_xref="UniProtKB/TrEMBL:E7B150"
FT                   /protein_id="CBY28029.1"
FT                   /translation="MIAEFETRILAQIDDMVEYANDDDLFAGGYLRGHLTLAVAESEEF
FT                   GEHTAEQLHARVQTSLDKAIKAGELSPPDQVLVLGLWDRLLEQAQLPH"
FT   CDS             complement(144025..146088)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01531"
FT                   /product="5-methylaminomethyl-2-thiouridine-forming enzyme
FT                   mnmC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28028"
FT                   /db_xref="GOA:E7B149"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7B149"
FT                   /protein_id="CBY28028.1"
FT                   /translation="MSHPPIQTATLSWNEQGTPVSEQFGDIYFSNEDGLEETHYVFLKG
FT                   NGFPERFALHPRDNCVFAETGFGTGLNFLTLWRDFAQFRQLHPAAKLQRLHYISFEKYP
FT                   LQVADLAAAHQRWPELACFAEQLRAQWPLPLAGCHRILLAEGAITLDLWFGDVNTLLPQ
FT                   LDSSLNNQVDAWFLDGFAPAKNPDMWNDVLFNAMARMARPGGTFATFTAAGFVRRGLQQ
FT                   AGFDVAKIKGFGQKREMLTGILPQRLNTQSEPWYHRPSATRCDDIAIIGGGIVSALTAL
FT                   ALLRRGAKVTLYCADALPAQGASGNRQGALYPLLNGKNDALEIFFTSAFTFARRQYSQL
FT                   LEQGIRFDHQWCGVSQLAFDAKSRGKIDKMLQTDWPASLAAAMSREQLSALAGLDCAHD
FT                   GIHYPAGGWLCPSDLTTELMALAQQNGMTCNYEHELHQLERINGQWQLTFKQSIANKQP
FT                   QASRQHATVVLATGHRLPEWEQTRHLPLSAVRGQVSHIPTTPVLSQLRQVLCYDGYLTP
FT                   VNPANQHHCIGASYQRGDVTTDFRADEQQENRDRLLRCLPDVSWPQQVDISDNQARCGV
FT                   RCAIRDHLPMVGAVPDYSATLAQYQDLPRKIQHGEDIPLAPVWPELFMVGALGSRGLCS
FT                   APLVAEILAAQMFGEPQPLDTTMLAALNPNRFWIRKLLKGRPVQHQASPFSG"
FT   CDS             146260..147483
FT                   /transl_table=11
FT                   /locus_tag="Y11_01541"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase, KASI"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28027"
FT                   /db_xref="GOA:E7B148"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:E7B148"
FT                   /protein_id="CBY28027.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFSQEFKDAGMR
FT                   SHVWGDVKLAPETITENIDRKVLRFMSDASVYAYLSMKQAIEDSGLTEKQVSNFRSGLV
FT                   VGSGGGSPRNQVAGSDGMRTKGLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSA
FT                   CATSAHCIGHALELIQLGKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNETPAKASRT
FT                   YDQDRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
FT                   MQMAMAGVDTPIDYMNVHGTSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAG
FT                   VHEAIFSLLMVEHGFIAPSINIEKLDEQAAGMNIVTEPTQCKLTTVMSNSFGFGGTNAT
FT                   LVMRKYQK"
FT   CDS             147903..148685
FT                   /transl_table=11
FT                   /locus_tag="Y11_01551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28026"
FT                   /db_xref="GOA:E7B147"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:E7B147"
FT                   /protein_id="CBY28026.1"
FT                   /translation="MRHNHSDQKLKIADLNERVVHEILEVISDGIWDWNANNGFVYRNR
FT                   GWYEMLGYPAHAFENTVHTWEKIIHPDDFERVMFQFDAYINQQAERYQIEYRCRTHDGD
FT                   YIWIEDRGKVIERNSDGTVSRMIGAHRNIHDRKNRLEKLELKNKTLEALVEERTTELRE
FT                   SNFQLQQQLDIKKILSETDVLTSAANRYLLEKVLKHEYNRAKRFCQPLSLLSLDLDNFK
FT                   SINDKYGHLVGDLTLTHTVDVIRNSIREIDVLGRWGGR"
FT   CDS             148690..148911
FT                   /transl_table=11
FT                   /locus_tag="Y11_01561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28025"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:E7B146"
FT                   /protein_id="CBY28025.1"
FT                   /translation="MIVLPNTQLTEAKSIAEKIRNLVEIMPVDGNIHVTMSLGVVELEQ
FT                   NESQEQLLIRADKMLYSAKAAGKNIIIG"
FT   CDS             complement(148949..149647)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01571"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28024"
FT                   /db_xref="GOA:E7B145"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:E7B145"
FT                   /protein_id="CBY28024.1"
FT                   /translation="MMKVLGLIGGMSWESTIPYYRMINQHVKEQLGGLHSAKIILYSVD
FT                   FHEIEQLQAKGDWQTAGQVLSDAALSLKRAGAEVVVVCTNTMHKVADEIETASGLPLLH
FT                   IADATAAQIKQQGINKIGLLGTRYTMEQDFYRGRLTEKHDIDVITPNSADREIINRIIY
FT                   EELCLGIINETSRQDYRRIIGHLEEQGAQGIIFGCTEITLLVNAQDAKVAVFDTTAIHA
FT                   KAAAQYALQP"
FT   CDS             complement(149847..151241)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01581"
FT                   /product="maltoporin (maltose/maltodextrin high-affinity
FT                   receptor, phage lambda receptor protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28023"
FT                   /db_xref="GOA:E7B078"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="UniProtKB/TrEMBL:E7B078"
FT                   /protein_id="CBY28023.1"
FT                   /translation="MKIYKQLPLAMAVIAALCPISVLAQETVTTITTEQLNKIVADAVE
FT                   KALAERKEKIEAATIQKPSVDIVEKASIPPSPDMAIPYGLKFNAYARYGAQFQAGDQKY
FT                   VGVDGSYNGSSAIGRLGNEGNGGEFQLSKAFKGDNGAIWDVVVMLDHWGDEVNLKKAYA
FT                   GVTNLFESQPNAYLWAGRDFHQRPQQGINDYFWMTHDGQGAGIKNLDLGGVQLDAAAVG
FT                   AVQSCSPEVVADQSNPSRITCTGGSGTGDNGHYALTSKIHGVKLGPINFELLTNYGFDS
FT                   KAIESEEKLKAWQTAVVLSHTGENIENKWVTRYSDNSDNSVYNKTADLRTIYTSVEGTY
FT                   KFTPQTSVTYLAAFHDYDRSNHNEDNRRNYGVIIRPMHFWNDVHSTWLEAGYQRVDYDT
FT                   GGDNKGWKLTLSQNISIAMGADFRPMLRFYVTGGEVDNKHTATTTDTEDTRLDSFNVGA
FT                   MWEAWF"
FT   CDS             complement(151628..151930)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01591"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28022"
FT                   /db_xref="GOA:E7B0M8"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M8"
FT                   /protein_id="CBY28022.1"
FT                   /translation="MIELEEAVMEIIVNAGQSRSLCFEALQAARKGDIDKAKNLLQEAD
FT                   GFARQAHHMQTKLIEQDAGEARQPMTLIMVHAQDHLMTSLLARELSEEIIHLYQR"
FT   CDS             complement(151945..153327)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01601"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28021"
FT                   /db_xref="GOA:E7B0M7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M7"
FT                   /protein_id="CBY28021.1"
FT                   /translation="MKYQFPDNFWWGSASSALQTEGESLRGGKSPTTWDAWYASQPSRF
FT                   HQQIGPNDTSTFYRNWKQDIALLNQLNHNSFRTSLSWARLIPNGVGEVNPEAVTFYNNV
FT                   IDELLAQGITPFITLFHFDMPMAMQEIGGWENREVIDAWKHYAEVCFELFGDRVKHWFT
FT                   FNEPIVPVEGGYLYDFHYPNVVDFRRAATVAYHTVLAHATAVRAYRAGSYEGEIGIVLN
FT                   LTPSYPRSQNPADLKAAECADLLFNRSFLDPALRGEYPQELIDLLCDYDQMPLRLQGDK
FT                   ALIAEGRIDLLGINYYQPRRVKCRDSAVNPQAPFMPEWLFDAYEMPGRKMNPYRGWEIY
FT                   EPGIYDILTNLRLNYGNPRCFISENGMGVENEERFIQDGKINDQYRIDFISDHLKWLHK
FT                   GISEGCNCLGYHMWTFIDNWSWCNGYKNRYGFIQLDLPSQKRTIKKSGEWFTATAANNG
FT                   FD"
FT   CDS             complement(153344..154675)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01611"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28020"
FT                   /db_xref="GOA:E7B0M6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M6"
FT                   /protein_id="CBY28020.1"
FT                   /translation="MSSLYQSMVAVIEQSITPLAGRLGQQKYVIAIRDGFTAALPFMII
FT                   GSFMLVFIFPPFSADTTIGFARAWLDFSQTYRAQLMLPFNLSMGVMTFFISVGVGASLG
FT                   RQFNLDPVMTGLLAFMAFLLVAAPFADGKISTQYLSGQGIFTALITAIYSTRVYAALKQ
FT                   HNITIRLPKEVPTGVARSFEILIPVLVIIATLHPLNLFIESQTGMIIPEAIMHLLAPLV
FT                   SASDSLPAMLLSVLLCQIFWFSGIHGSLIVTGIMSPFWMTNLAANQAALAVGATLPHIY
FT                   LQGFWDHYLLIGGVGSTLPLAFLLLRSKVTHLRTIGKLGVVPSFFNINEPILFGAPIIM
FT                   NPIMFIPFICVPMINAVLAYTATKLGWLAQVVSLTPWTTPAPIGASWAANWAFSPVVMC
FT                   LICMMVSALIYLPFLRAYERSLVKTEGEKVSGNAPSLSDTIRSN"
FT   CDS             complement(154688..155002)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01621"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28019"
FT                   /db_xref="GOA:E7B0M5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M5"
FT                   /protein_id="CBY28019.1"
FT                   /translation="MFKIMLCCSAGMSTSMLVKKMRVVADERGIPVEIDAFGVSEFDTQ
FT                   FPRYQVVLLGPQVKYMLGMLSEKAAAHGIPVQPIDMMDYGMQRGDKVLDYALSLINATH
FT                   "
FT   CDS             155354..156310
FT                   /transl_table=11
FT                   /locus_tag="Y11_01631"
FT                   /product="catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28018"
FT                   /db_xref="GOA:E7B0M4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M4"
FT                   /protein_id="CBY28018.1"
FT                   /translation="MSTINDVSRLAGVSKATVSRVLSGSRGVKEASRLAVLKAVDELNY
FT                   RPNVIAQSLLSQSTGCIGVICAQENINQTTGYLYALEKHLSQHQKHLLLRFANNKAEVM
FT                   QALDELTCGLCDDVLIIGARFPLNLADESIILVDCMDIDATNSIHFDHAFAAETACNYL
FT                   IKQGRRKIALINPDSSGYVDEVLLGYKRALENNFLPFNRDLIFMDSSSSSVALQVLLNS
FT                   SATLNFNALLVADEREAQSVIPQLQAFNKSVPDDIMVFSLAGSLHYPGVPTIPAIEYSM
FT                   DAMAAKIVAWLNEKTKNVLGSYALRGDLIIPDMPARK"
FT   CDS             156584..157885
FT                   /transl_table=11
FT                   /locus_tag="Y11_01641"
FT                   /product="glucose-1-phosphatase precursor"
FT                   /EC_number="3.1.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28017"
FT                   /db_xref="GOA:E7B0M3"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M3"
FT                   /protein_id="CBY28017.1"
FT                   /translation="MIKVKTAYTLTLLAIFLPASPHIMAQDKSDNYKLEQVLVMSRHGI
FT                   RAPLVNYGDMLSSATPDKWPQWTTPGGYLTPKGAELEAMMGGYFREWLADTKLLKSKGC
FT                   PVTTTVFTYANSLPRTIDTAQHFLFGAFPGCNVPVVHQKEIGKMDPVFNPIITLDITPE
FT                   FKEKALASINQHAGPGGVEGLNKRLQPNYDLLSKVLDYKNSPACLVDKKCDWSAQPTDI
FT                   VLVQNKEPGITGPLRLGTGASDAFMLQYYEGFPAKDVAWGRIHSSEEWRKLIDIKNLYH
FT                   ETLFGSPAIADNAAEKLVGFISSALDPVGEKTPNELAAQKAKLAVLVGHDSNIASLLAA
FT                   LKTKEYQLPDQYEKTPISGKVVFERWKDIKQNKELMKIEYIYLSTEQIRNKTPLSLQAP
FT                   PKRVTLEIKGCPIDAKGFCSMDDFRKAIKQNTQI"
FT   CDS             158055..159134
FT                   /transl_table=11
FT                   /locus_tag="Y11_01651"
FT                   /product="arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28016"
FT                   /db_xref="GOA:E7B0M2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M2"
FT                   /protein_id="CBY28016.1"
FT                   /translation="MKDRLLHILLILGLGLTALMPTKISAFPQFIDWTTIVTLLGLMLL
FT                   TKGVEVSGYFDFIGRKIINTLQTERYLALFLVLSAAVLSSFLTNDVALFIIVPLILTLK
FT                   KISALPVSRLIIFSALAVNAGSLLMPIGNPQNILLWSRSELSFIGFTLQMAPLAATILL
FT                   ILLAVTWWRFPARKISKQTSSPVYPYQSRLLLSCLALYVIFIICVDFGWAVYGLLVVFA
FT                   GLLLLARRVLLAIDWSLIVVFMAMFIDVRLLTELPGLQSLFGEIKILSAAAAYILGIGL
FT                   SQVISNVPATILLLNYLPSSALVAYAVNIGGFGFALGSMANLIALRMAGEPAIWLKFHA
FT                   YSLPFLFWSGLVGWLLLVL"
FT   CDS             complement(159201..160238)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01661"
FT                   /product="putative flagellar assembly regulatory
FT                   protein,Flk"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28015"
FT                   /db_xref="GOA:E7B0M1"
FT                   /db_xref="InterPro:IPR023597"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M1"
FT                   /protein_id="CBY28015.1"
FT                   /translation="MQPLNGPGVPIANDRNVAPTKLPSAGQVEERALTPAQRTTLEKLI
FT                   VRIMALSPIKSAEIWAGLRHDLSLSSTSDLLARHFQPAEQLLQTRLSQAQENHANHQLR
FT                   QQLTELLPQGNNRQAVSDFIRQQFGHTVLSQLSHAELQQVLVLLQSGTLNIPQPQLTTI
FT                   TDRPLLPAEHQHIQSLVAKLSAATGEQPAKIWQALFDMVGVKSNDPLPARHFQILSQFL
FT                   QAKVALSQQTAPTLINLQTALKQPADAQEQQLLIDYSQNRFQASPTTPLTQAQLNDIIN
FT                   VLFAARLDRANAAQRLAEDQKTIQPLINPLIAALPQSLQPLLQKPSLAFVALIIVMAFL
FT                   LAIFL"
FT   CDS             160268..160384
FT                   /transl_table=11
FT                   /locus_tag="Y11_01671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28014"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0M0"
FT                   /protein_id="CBY28014.1"
FT                   /translation="MWWIYGDPRVAGIIPVNVRDPYRQIMFLAKWLCNEMSL"
FT   CDS             160607..160894
FT                   /transl_table=11
FT                   /locus_tag="Y11_01681"
FT                   /product="suppression of copper sensitivity: putative
FT                   copper binding protein ScsA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28013"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L9"
FT                   /protein_id="CBY28013.1"
FT                   /translation="MTQRIASLHALEKSLLLPSSSQVVANANDAPTPCELSAKSLLASP
FT                   PVLFELAIFSLGLLLLLLVPIIPTSMRFPPPRVISPSGLRVHLRLCIFRE"
FT   CDS             160945..163005
FT                   /transl_table=11
FT                   /locus_tag="Y11_01691"
FT                   /product="membrane protein, suppressor for
FT                   copper-sensitivity ScsB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28012"
FT                   /db_xref="GOA:E7B0L8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L8"
FT                   /protein_id="CBY28012.1"
FT                   /translation="MFNLSKAALFCLLLLWMPTLWAADSGWLVSAQNDHAKVRVRAEPS
FT                   AGNETRMLLSVRLEKGWKTYWRSPGEGGIAPAITWSPPLETVKWYWPVPQRFDVSGIST
FT                   QGYHDHAVLPIVISGKVPKTLSGTLTLSTCSNVCILTDYPFSLDMSAAVSAEKQQQFEH
FT                   DFAQAMGQVPIANALTQQIQAGFSQGEVQILALRDDGWQKPELFFDTLEDVDLGNPVVT
FT                   VQGNQLSVRVPATDGWGEGVGDLRGKPLTLMITDGELAQEATVTIGPALTLPQSSSSFW
FT                   SWILMALAGGLILNLMPCVLPVLAMKLGSILQTEHQTRRQVRWQFLASSAGIITSFWLL
FT                   ALLMTALRLGNHALGWGIQFQNPWFIGFMVLVTALFTVNLFGLFEIQLSSSLNTRIAAP
FT                   RIEKPGARGMAGHFGQGALATLLATPCSAPFLGTAVAFALAAPLSALWGIFTALGVGMS
FT                   LPWLAVAAWPKLALCLPRPGRWMNHLRIAMGVLMLASSLWLLSLMVSHIGLQTVIIIAA
FT                   IALLALLLAIGRRYGTRIAAIVSLIVALIVGGLLLVGSLTADLWRKPLHDNIPWQPLTE
FT                   TAIKKALAEHKRVFVDVTADWCVTCKVNKIHVLMRDDVQQALQAPDVVALRGDWTRPSA
FT                   DITAFLRERGSVAIPFNQIYGPQQPQGVVLSPLLDRDVLLKALADAKGNEK"
FT   CDS             163002..163727
FT                   /transl_table=11
FT                   /locus_tag="Y11_01701"
FT                   /product="secreted protein, suppressor for
FT                   copper-sensitivity ScsC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28011"
FT                   /db_xref="GOA:E7B0L7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L7"
FT                   /protein_id="CBY28011.1"
FT                   /translation="MRMLTVLLFVMFSNPLWAAAPFTPEQEVRIKELIRETLISNPDIL
FT                   EQSVNAWQQQANEAQGQQLSQFIAANKQALYQDPGSPRFGATTPQLTLVSFTDYNCPFC
FT                   KTFDPLLEKLVKEYPQVAVVIKPLPFKGESSMTSARLALTLWQQHPEQWMAFHQRLMAK
FT                   KGFHDAGSIAAAQKKIGVTPAALSEQSLNVLRSNLKLADQLGIQGTPATLIGDQMVPGA
FT                   ISYQELEEIVRQQLALAGK"
FT   CDS             163724..164224
FT                   /transl_table=11
FT                   /locus_tag="Y11_01711"
FT                   /product="membrane protein, suppressor for
FT                   copper-sensitivity ScsD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28010"
FT                   /db_xref="GOA:E7B0L6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L6"
FT                   /protein_id="CBY28010.1"
FT                   /translation="MNRLKRWGKELMVLLLLVVVVSVTMDWLRSPQAPANWPDTPRQTL
FT                   AGKAVSLSEMSQEKPLLIYFWATWCGVCKFTTPSVNQLVQEGENVLTVALRSGDPAQVE
FT                   TWLRKKGYQLPVINDPQGELSAQWQINVTPTVVILYQGKMVQHTSGWTSYWGMKLRLWL
FT                   ASF"
FT   CDS             complement(164281..165738)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01721"
FT                   /product="transcriptional regulator, GntR family domain;
FT                   Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28009"
FT                   /db_xref="GOA:E7B0L5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L5"
FT                   /protein_id="CBY28009.1"
FT                   /translation="MHIPLDRQQDIPLYLQIEEALRRAILSGVFADGDKLPSTRTLAAE
FT                   LSVSRLTVDNAYAELAAKGFLQQRRGSGAYVRHLPPPPSQPQPLLPGEFPLDRFTTVTS
FT                   RLDGYADIPLPPDTINFAAGIGSPKIFPLDEFRQILQSILRRHAEEAFSYGDYCGYYPL
FT                   RDTLSRILSAQGIATRPEQLLITNGSQHAISLVSQSLLAPGDTMLVEEPTYAEAIALFR
FT                   LHKVNVVALPSDQQGMQLDMLPTLLVKHQPKLIYCIPNFNNPTGRCLSESRRHQLLHIA
FT                   RAAGVPILEDDYVGDLRYSGKKLPSLRSLAAPGEVIYVSTFSKMLLPSMRIGYLVADQP
FT                   HYTQLARLKHVDSFTSSNLIQRALDAFVTVGRYDKQLRRACRLYRQHRDVMVETLTQTL
FT                   PPDCQFEIPDGGLFIWLQLPQNAPISRLMPLAWQAGVTFAKGGGFHTQEAYGEFTLRLN
FT                   FAANSPELITQGINRLSAAIRKCGAEN"
FT   CDS             165920..166963
FT                   /transl_table=11
FT                   /locus_tag="Y11_01731"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28008"
FT                   /db_xref="GOA:E7B0L4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L4"
FT                   /protein_id="CBY28008.1"
FT                   /translation="MAMPAGLPPSIIRAPLVGSGFLTGKRQGYVLALISAMLLGFTGII
FT                   IRILTAHYHLPTSVLAFWRAGLVAAVLLPILLVIKPEWAKLRRDQVKFYLAYGLLLAVF
FT                   NGLWTESVALNGASISTILVYCSVGFTVFLGWIFYNEYMGWREFFVIVISMVGCFLVSD
FT                   GVNITAADFNFVGLFIGLASGIGYSFYTLAGRIATDRRYPVWNTILYVFGLSAVYQLIF
FT                   NQLLLWFPIQGLQQMVGNLFFLSIGTEGVQWSGWWLLLILAAGPTLLGFGLFNLSLKTL
FT                   PLAIASLILTLELVFTAVIAYFLLDEILSASQLLGSALVLLGVLMLHRNDNTQGEIATP
FT                   SNSAISP"
FT   CDS             complement(166973..167860)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01741"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28007"
FT                   /db_xref="GOA:E7B0L3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L3"
FT                   /protein_id="CBY28007.1"
FT                   /translation="MFMNVLFPLFAVIIWSINAVVSKVSATAIDPAAISFYRWVLALLT
FT                   LTPFLLMGVIRNWQAIRVYWWKLMILGLLGMVLYQSLAYYAAHSVSALFMGILSSLIPL
FT                   LTVLISIVVLRVAPTIGIALGSVLSLGGLVWLVSAGNPAQLLQHGIGKGELMMFGASAS
FT                   YALYGVLTKRWAIQLPNWQSLYIQIVFGVVLLLPNFLLAADVQLTAQNIPLVLFAGIPA
FT                   SIIAPYLWIHGVMRLGANTASIFMNLTPVFTAIIAVTFLHEQLHSYHLIGGGITLAGVI
FT                   LAQRLRTPLRRKTA"
FT   CDS             168024..168812
FT                   /transl_table=11
FT                   /locus_tag="Y11_01751"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28006"
FT                   /db_xref="GOA:E7B0L2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L2"
FT                   /protein_id="CBY28006.1"
FT                   /translation="MMIKPNIPMVADTAPQNLSFRCEIYNANTEFLPHTHSYGQLICVK
FT                   SGVLAMSIGGQRFLAPPEFSVWIPAGVEHSSYNRKLMHFRAIDIALEHCKELPSSACLI
FT                   NVSPIFNTIVEDCFARGLLMPQSEQDLRLSLVLIDQLRVSPVQCTYLPTSQDKLLSPIL
FT                   AALERCPSDNTSLAVWAKRVYTTERTLSRRCQQELGMAFSEWRQRLRFLHAISLLEQGR
FT                   TVQSVALDVGYSSASAFITMFQQISGTTPERFRRANPLLP"
FT   CDS             169031..170158
FT                   /transl_table=11
FT                   /locus_tag="Y11_01761"
FT                   /product="erythronate-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.290"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28005"
FT                   /db_xref="GOA:E7B0L1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L1"
FT                   /protein_id="CBY28005.1"
FT                   /translation="MKILVDENMPYADALFQRLGDVQAVPGRPIPLDALAGADALMVRS
FT                   VTKVNEALLQGTSIRFVGTATAGTDHVDDNWLQQQGIGFSAAPGCNAIAVVEYVFSALM
FT                   MMAERDGFQLLDKTVGIIGVGNVGSRLNARLQALGVRTLLCDPPRADRGDNERFWPLEK
FT                   LVREADVLTFHTPLNKNGPYQSLHMADDELLAALPDGRILINACRGAVVDNTALLRALE
FT                   KGKKLSVVLDVWEPEPELSLPLLARVDIGTPHIAGYTLEGKARGTTQVFEAFSQYLGQP
FT                   QSVELANLLPQPEFSQLRLNGELDEGKLKRLMHLVYDVRRDDAPLRRVAGQSGEFDRLR
FT                   KHYQERREWSSLCVQCDDAASAELLQKLGFSTQLL"
FT   CDS             170382..171440
FT                   /transl_table=11
FT                   /locus_tag="Y11_01771"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28004"
FT                   /db_xref="GOA:E7B0L0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0L0"
FT                   /protein_id="CBY28004.1"
FT                   /translation="MLPPLFLYQSFVEKTNMSDGWNIALLGATGAVGEALLELLNERQF
FT                   PVGELYPLASERSAGATVRFNGKSVLVENAAEFDWSQAQLAFFVAGREAAQQYAEEAAN
FT                   AGCLVIDSSGLFAMEQDVPLVVPSVNPQVLAEYRNRNIIAVADSLTSQLLTAIKPLTEQ
FT                   AGLSRLHVTALISASAHGKAAVDDLAGQSAKLLNGIPAEPGVFAKQLAFNVLPLLADEE
FT                   GSVREERRLVDQVRKVLQDEGLPISVSCIQSPVFYGQAQVVHLEALRPIAAEEARSELE
FT                   SCDDIQLSEEDDYPTQVTDASGSDVLSIGCIRNDYGIPEVLQFWSVTDNIRFGGALMAI
FT                   ETAERLLQEQLS"
FT   CDS             171440..172282
FT                   /transl_table=11
FT                   /locus_tag="Y11_01781"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28003"
FT                   /db_xref="GOA:E7B0K9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K9"
FT                   /protein_id="CBY28003.1"
FT                   /translation="MYELELTQPENTVAETAGIKIALGIEYNGSRYFGWQRQQEVASVQ
FT                   ACLEAALSKVANEPIGVLCAGRTDAGVHATGQVVHFITTAERKNAAWTMGVNSHLPPDI
FT                   AVRWVKTVDDGFHARFSATARRYRYIIFNHRYRPAVLAQGVTHCYMPLDAEKMEQAAQC
FT                   LLGEHDFTSFRAIQCQSRTPWRNVKHVKVTRHGAYIVVDIKANAFVHHMVRNIVGSLIE
FT                   IGCGNQSVTWMAELLALKDRARAAATAKAEGLYLVSVDYPDHFALPKTPLGPLFLADD"
FT   CDS             172414..173076
FT                   /transl_table=11
FT                   /locus_tag="Y11_01791"
FT                   /product="DedAprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28002"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K8"
FT                   /protein_id="CBY28002.1"
FT                   /translation="MEFIRFVIDFILHIDVHLAELVAQYGVWVYGILFLILFCETGLVV
FT                   TPFLPGDSLLFVAGALASLPSNDINVHIMVALMVTAAILGDAINYSIGRVFGEKLFSNP
FT                   DSKIFRRSYLDKTHQFYEKHGGKAIILARFVPIIRTFAPFVAGMGKMSYRHFAAYNVIG
FT                   ALVWVLLFTYAGYWFGNMPFVQDNLKLLIVAIIVVSILPGVFEVWRHRRAAARQKNQ"
FT   CDS             173307..174218
FT                   /transl_table=11
FT                   /locus_tag="Y11_01801"
FT                   /product="acetyl-coenzyme A carboxyl transferase beta
FT                   chain"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28001"
FT                   /db_xref="GOA:E7B0K7"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K7"
FT                   /protein_id="CBY28001.1"
FT                   /translation="MSWIERILNKSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNL
FT                   EVCPKCDHHMRMSARARLHMLLDAGSEVELGSELEPKDILKFKDSKKYKDRLSAAQKET
FT                   GEKDALVAMKGTLQGMPIVAVSFEFAFMGGSMASVVGARFVRAVEQALEDNCPLVCFSS
FT                   SGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASLAMLGDINIAE
FT                   PKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKLTH
FT                   QPQPSVDGVKADAAVADNQGNA"
FT   CDS             174184..174321
FT                   /transl_table=11
FT                   /locus_tag="Y11_01811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY28000"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K6"
FT                   /protein_id="CBY28000.1"
FT                   /translation="MRLWQIIRVMPDYLNGLHPDMVVPGYRALSQLKLYSFKKENIYPK
FT                   "
FT   CDS             174454..175722
FT                   /transl_table=11
FT                   /locus_tag="Y11_01821"
FT                   /product="dihydrofolate synthase; Folylpolyglutamate
FT                   synthase"
FT                   /EC_number="6.3.2.12"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27999"
FT                   /db_xref="GOA:E7B0K5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K5"
FT                   /protein_id="CBY27999.1"
FT                   /translation="MKNHQTPQATSPLAAWLYYLERLHSQPIELGLERVKQVAERLDLL
FT                   KPAPKVFTVAGTNGKGTTCCTLESILLAAGLRVGVYSSPHLLRYTERVRIQGQELPEAE
FT                   HSHSFAKIEAGREDISLTYFEFGTLSALQLFKQAKLDVVILEVGLGGRLDATNIVDSDV
FT                   AAITSIAIDHTDWLGFDRESIGREKAGVFRAGKPAVVGEPDMPQSIADVAATLGAHLYQ
FT                   RDIAWQFSQHGSFDQPQNGWNWLCGDRQLNDLPLPNVPLANAATALAVLHYSGLSLSED
FT                   VIRQGLQAASLPGRFQIISEQPLLILDVAHNPHAARYLTDKLAQLPKQGKVRAVVGMLS
FT                   DKDIGGTLACLSEQVDKWYCAPLEGPRGASAEQLAEHLAQSRQFSDVETAWRQAMQDAE
FT                   PQDVVIVCGSFHTVAHVMAAMDL"
FT   CDS             175762..176481
FT                   /transl_table=11
FT                   /locus_tag="Y11_01831"
FT                   /product="dedd protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27998"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K4"
FT                   /protein_id="CBY27998.1"
FT                   /translation="MASKFQNRLVGTIILVALGVIVLPGLLDGKKKHYEDEFAAIPLVP
FT                   KPGDSQEIDAVPPVSQPLPIAPPEGVAQAVAVPKDDSTSQAANDAGNLPSEPTIVAPPP
FT                   VQSKPVEVKPVEKKPAEVKPVPVEKKPQEVKPKPEVKPQVQPESKPVAEEKAPVGQAYV
FT                   VQLGALKNAAKVNEIVATLRLSGHRAFTVPATPVQGQITRVYVGPDASKQKLQSALPEL
FT                   NSLSGLNGQVKPYGTGR"
FT   CDS             176787..177296
FT                   /transl_table=11
FT                   /locus_tag="Y11_01841"
FT                   /product="colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27997"
FT                   /db_xref="GOA:E7B0K3"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K3"
FT                   /protein_id="CBY27997.1"
FT                   /translation="MVWIDYVIIGIIGFSALVSLIRGFVREALSLVTWGCAFFVASHFY
FT                   SYLAIYFTRFEDEVVRNGIAIGILFIATLIVGAIVNYVIGSLVERTGLSGTDRVLGICF
FT                   GALRGVLIVSAMLFFLDTFTGFSQSVDWKQSQLIPQFSYIIRWFFDYLQSTSSFLPNQL
FT                   PIRSGL"
FT   CDS             177309..178826
FT                   /transl_table=11
FT                   /locus_tag="Y11_01851"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27996"
FT                   /db_xref="GOA:E7B0K2"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K2"
FT                   /protein_id="CBY27996.1"
FT                   /translation="MCGIVGIAGFAPVNQSIYDALTVLQHRGQDAAGIVTIDAHNGFRL
FT                   RKANGLVKDVFETRHMLRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPFGITLAHNGN
FT                   LTNAHQLRKELFEVSRRHVNTTSDSEILLNIFASELDRFQHYPLESDNIFAAVAATHQL
FT                   IRGAYACVAMIIGHGMVAFRDPNGIRPLVMGKRTLADGRNEYMVASESVALDTLGFEFL
FT                   RDVAPGEAVYITEKGQLFTRQCAENPKYNPCLFEYVYFARPDSFMDKISVYSARVRMGQ
FT                   KLGAKIAKQWEDLDIDVVIPIPETSCDIALEIARILDKPYRQGFVKNRYVGRTFIMPGQ
FT                   QERRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIVEMAREAGAKKVYFASAAPE
FT                   IRFPNVYGIDMPSANELIAHGREVDEIRQLIGADALIFQDLSDLIEAVREDNPDITQFE
FT                   CSVFNGVYVTKDVDQSYLEYLESLRNDDAQALRSHNEAENLEMHNEG"
FT   CDS             179156..179728
FT                   /transl_table=11
FT                   /locus_tag="Y11_01861"
FT                   /product="3-polyprenyl-4-hydroxybenzoate carboxy-lyase
FT                   UbiX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27995"
FT                   /db_xref="GOA:E7B0K1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K1"
FT                   /protein_id="CBY27995.1"
FT                   /translation="MKRLIIGISGASGAIYGVRLLQVLKQVEGIETHLILSNAARQTLA
FT                   LETDFSVKDVQALADVVHDSRDIAACVSSGSFKTCGMVILPCSIKTLSGIVHSYTDGLL
FT                   TRAADVILKERRSLVLCVRETPLHLGHLRLMVQAAELGAVIMPPMPAFYHRPQTIQDLV
FT                   DQTVNRVIDQFDIELPEDLFIRWQGTR"
FT   CDS             180037..180819
FT                   /transl_table=11
FT                   /locus_tag="Y11_01871"
FT                   /product="histidine ABC transporter, histidine-binding
FT                   periplasmic protein precursor HisJ"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27994"
FT                   /db_xref="GOA:E7B0K0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0K0"
FT                   /protein_id="CBY27994.1"
FT                   /translation="MNKKILVLPLVLALAAASTAFAAIPKDIKIGTDPTYAPFESKNAS
FT                   GELVGFDIDIAKELCNRIDTKCTFVESDFDALIPSLKAKKIDAIISSLSITEKRQKEIA
FT                   FTDKLYAANARLIAPKDSKIEPTLVALKGKRVGVLQGSTQEAFANAEWQPKGIDVVAYQ
FT                   NQDLIYSDLSSGRIDAAFQDEVAGSEGFLKQEAGKGYAFAGPSVKNDEFFGVGTGMGLR
FT                   KDDAELKAALDKAFAEMRKDGTYDKLAKKYFDFDVYGG"
FT   CDS             180924..181610
FT                   /transl_table=11
FT                   /locus_tag="Y11_01881"
FT                   /product="histidine ABC transporter, permease protein HisQ"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27993"
FT                   /db_xref="GOA:E7B0J9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J9"
FT                   /protein_id="CBY27993.1"
FT                   /translation="MLDGYSKLIFEGALVTLELALCSVLLSVIIGLIGAGGKLSSNRLL
FT                   SGLFECYTTLIRGVPDLVLMLLIFYGLQIVLNSITESLGFAQINIDPLSAGIITLGFIY
FT                   GAYFTETFRGAYMAVPTGQIEAARAFGFSSSQIFRRIMFPAMMRYALPGIGNNWQVILK
FT                   ATALVSILGLNDVVKATQLAGKGTYQPFFFALVAGVVYLIFTTLSNGILLWLERRYSHG
FT                   VKRAEL"
FT   CDS             181607..182323
FT                   /transl_table=11
FT                   /locus_tag="Y11_01891"
FT                   /product="histidine ABC transporter, permease protein HisM"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27992"
FT                   /db_xref="GOA:E7B0J8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J8"
FT                   /protein_id="CBY27992.1"
FT                   /translation="MIEILHQYWQALLWSDGYRFTGMAVTLWLLITSVVMGGLLAIPLA
FT                   VARVAERRWIRLPVWIFTYIFRGTPLYVQLLVFYSGMYSLEIVRGNDLLNAFFRSGLNC
FT                   TILALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSRFKMYRCIILPSALRIALPAY
FT                   SNEVILMLHSTALAFTATVPDILKIARDINAATYQPFYAFGIAAVLYLIISFTLISLFR
FT                   QAEKRWLAHIKPQASH"
FT   CDS             182338..183156
FT                   /transl_table=11
FT                   /locus_tag="Y11_01901"
FT                   /product="histidine ABC transporter, ATP-binding protein
FT                   HisP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27991"
FT                   /db_xref="GOA:E7B0J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J7"
FT                   /protein_id="CBY27991.1"
FT                   /translation="MTDTLRTMTDTLKPKIAETKLSVTELHKHYGEHEVLKGVSLSAKA
FT                   GDVISIIGSSGSGKSTFLRCINFLEKPSEGSISVNNQDIRLVRDKDGQLKIFDKKELQL
FT                   LRTRLTMVFQHFNLWSHMTVLENVMEAPVQVLGLSKSVAKERAIRYLDKVGIDERARAK
FT                   YPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQKLAEEGKTMVV
FT                   VTHEMEFARHVSSHVIFLHKGLIEEEGPPAELFDNPKSPRLQQFLSGALK"
FT   CDS             183351..188234
FT                   /transl_table=11
FT                   /locus_tag="Y11_01911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27990"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J6"
FT                   /protein_id="CBY27990.1"
FT                   /translation="MGYVKDESFYFDQTNDLLVKLKKSIFEIGYYSISQGDEKAAKQFH
FT                   NGICYALSAKFLMEERNYGVGGGKRYFNWLQQAIVSYKKNAAISNRDPTDIKRKLLMQY
FT                   HRQFLYTELELLQKIQYSQNIRSNHIKLRVDFENIITFLLSKDAVVTNFDVLKFYCEIK
FT                   ENAVYGKIKYKKLVDIINKYVAGNSEVFEEIINSTKKNGKGKSYKIESLADNILMGFYK
FT                   KLDGGGANENFMVTSKDFALLLGEAILAEKKRYHDNYGAFLLKRGLYPFGIGNEDYKQQ
FT                   VMTNSLTEREAKYNVLMSSLANIDKSVYVSLLSPTHAMAISVIKDRTSTYWTFFDPNNG
FT                   AKVYDNYAEFKSHVDNLLTKEGYFNQSVKDTLVANFDFSVDYIKFEENPNHKNDDSVWK
FT                   RARDGEEAYVLKSMKENKIIFDINNSKNTARIIDFALYDDSNKVKNIVVEINSDTIVFN
FT                   VHIENYSVDSVFRELKKDINRILKYQVENGMIKDISYSGYISPFKGAPLSLFKGTPPGK
FT                   YKDIPCYNPELESLNARAKNAIQTLDLLSQGRVSPVEISSDPKAALTTFFDSGSDELTN
FT                   REILKNITDSKYYLKSRQELLTLQYVSTNNPEFATIKPHQALEFSKEWYVNKVENKLWL
FT                   MNNSIKYNINNASNSSQNLTLALDLNLSIKRQINLGVLYLYYASKGEKNKFKNKINKYN
FT                   ELNYVSASGFASKYELEQLDKFRQNFYALDEIKYIDIHKKVLTEKMENGIKLDDSGGYQ
FT                   LMVNDKVFNLFCHKSRDGYIYSVYNTEGWEYSFSANNQENANKKLSLILNDYLSDLNDG
FT                   RELLQIEYHLYHLEFPVSSDFYAQVPLGNLYQQKIVSERDKLVKLGMTYLNGDTISYST
FT                   LYDMGMAIDGKIITTAAISANANWRNHLHFDPSKLNDFYTATYPTNPELQLSLKVVRKL
FT                   FINDDSASSLLLPHHDPLVVNEAQKRLDTIKHFVNTDGKISPYLWRGFATVTATSSRLQ
FT                   SIGAYTGKATQLFSIARLSVSSVSMSKRLQDPNLSDEERQEIIKQLALGWSSTVADFGT
FT                   DVMQPAFNKLHYYFNKKLSSGSRYGAARLGYQAGAKSAKYAGSALNMASAAFDIYNAID
FT                   NLSKAIKETNPELRNDYFINSSFSIIGAAVSIATAVALAIGMSTAGPIGILTGAAIMLG
FT                   GMTYNAIRQVEYIKREIDLSGWEIFKTGIRLAFGTEPEQYIVQRLKDKDKEKLEKHIKD
FT                   LLENAFEQRIKPMGYNNYLYVNEEIDLSPVKKYVFVYKIDHAENYSEYDINNIIREKNL
FT                   TGYMHDDNYEFSDVFSGKRNYKVPYVYRYALMRDARSPLSENELNHWKKTVNVDDFHII
FT                   EKDVIDLHNRNAQNNAIIKDMDMFNIHPALNSMRSYWHDRNKDTETSILSIKSDNVEDF
FT                   STHFNLGWGNDLAIGYKGYKNSFDVGQGSKIFIGGDKEDVFYLMDNVEASVHSPASVLD
FT                   GQDGSDTLIVMGLRFGNEGYELNLARGYVKYINNELRLATLLSIENAYGQKDKKDLLIG
FT                   NDNVNVLNGGGGYTEDRLEGGGGNDILTLLRGTAVGGEGIDTYIISSASYSAAHVVIYE
FT                   DAQDEVSIIQLQAKSDRIESIELKNNDIVIRFIDDYNYNSTVVLKDAI"
FT   CDS             188185..189678
FT                   /transl_table=11
FT                   /locus_tag="Y11_01921"
FT                   /product="putative calcium binding hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27989"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J5"
FT                   /protein_id="CBY27989.1"
FT                   /translation="MTIIIITARLCLRTLFKLNSYGDKKELTHSYILNTSDNMILVPNW
FT                   PAVLDKDIINLDSSLEMLAFYNPLIEQNLNEDVQSVERTRVTITKYLYKGDLIKINDEE
FT                   INFPPFIKASLNGHKATIDTIFGNGLGSTFENLGGGDFITANGGDNIYHIPNLLLTVGN
FT                   KNNTLRLECGILAGGPHGNNTVHLVLDDVSGYDLNVDKNLLGDIVIKHKDNPDAFVSIE
FT                   ISNTHKLTLVDGKQLITLIDKNEKLFYIDLSAEIFELLEMQPTLYTTTEDNDNIVIPDS
FT                   YRLADNRLYAKHGDDVISDLSGRGHKIYGDVGNDIIYAKGGNNMLSGGDGNDELFGGNG
FT                   NDLLYGGQGDDILNSGDGINVFAGEEGDDSYVFEPGHGDNIIFDNKGRNSIIFKGIDYR
FT                   VLQFKKQDSNLTININNSNKAVTIANYFVVGAEQRARLFTFKTDEYQLAGDNLSLLIDS
FT                   MSSTSDLRWEPVQSLVNSSNNWYADPIRPSIVKLESTVG"
FT   CDS             complement(189749..190657)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01931"
FT                   /product="cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27988"
FT                   /db_xref="GOA:E7B0J4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J4"
FT                   /protein_id="CBY27988.1"
FT                   /translation="MRIVITGATGLIGRSLNAFLLSQAHQITVLTRDPQRANDVLGSQV
FT                   TCWSTLDDQHDLNNFDAVINLAGEPIAEKRWTPQQKEILCQSRWQITERLTTLIRASSQ
FT                   PPAVFISGSAVGFYGDQGQAVVTEDEAPHDEFTHMLCERWESLARAAESQHTRVCLLRT
FT                   GIVLAPHGGALAKMVPLLRLGLGGPIGDGRQYLPWIHIDDMVHGIYYLLTTNGLSGPFN
FT                   MVSPYPVHNEQFIATLAEVLDRPAVIRTPAAAIRLLLGESAALVLGGQRAIPKRLEEAG
FT                   FAFRYFELEEALRNVLNKPVA"
FT   CDS             191166..191858
FT                   /transl_table=11
FT                   /locus_tag="Y11_01941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27987"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J3"
FT                   /protein_id="CBY27987.1"
FT                   /translation="MKLNIEVNCSYVCEPIHKQDGSLLAVELLSRFSAKSVDLPIDVEN
FT                   FINKLDVDGKTDLFHDQLRAVKAYKDWFITHNVLLSINIDFDLASVIVTDQSTRQMLDE
FT                   LPFLRLEIMETFSNLSDGMNNPLLRDLAERYPLWLDDLGSGGSTLNAVTANIFEYVKID
FT                   KHFFWQHNKHTFPILINNIKKYCLGVIVVGVENQDESEQLKGSNIDAMQGYLFNQLTLD
FT                   ELVSQSSL"
FT   CDS             192104..192649
FT                   /transl_table=11
FT                   /locus_tag="Y11_01951"
FT                   /product="phosphodiesterase yfcE"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27986"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J2"
FT                   /protein_id="CBY27986.1"
FT                   /translation="MFASDLHGSLPATKKTLEIFDRSGAQWLVLLGDLLNHGPRNALPT
FT                   GYQPAAVAECLNPYKNQIIAVRGNCDSEVDQMLLQFPIMAGWQQIIMPETRLFLTHGHL
FT                   YHPAALPPLRKGDVLVYGHTHLPQAEWQDDVICFNPGSVSIPKGGYPASYGMLDGGVLQ
FT                   VLALQNDEPVTQLSLKTK"
FT   CDS             192721..193269
FT                   /transl_table=11
FT                   /locus_tag="Y11_01961"
FT                   /product="putative Nudix hydrolase YfcD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27985"
FT                   /db_xref="GOA:E7B0J1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR024195"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J1"
FT                   /protein_id="CBY27985.1"
FT                   /translation="MVEQNPAAVIEWVDIVDEQNEVIAQSSRQQMRTQRLRHRATYIVV
FT                   HDGMGKILVQRRTESKDFYPGKLDATAGGVVQSGENYLESARREAEEELGIAGVPFAEH
FT                   GQFYFEEECCRVWGALFSCVSHGPFALQAEEIDEVRWMLPEEITARCDEFTPDSLKALS
FT                   LWLTRNNEQDYGKITPRED"
FT   CDS             complement(193646..193918)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01971"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY26690"
FT                   /db_xref="GOA:E7B0J0"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0J0"
FT                   /protein_id="CBY26690.1"
FT                   /translation="MLPREFSSGGKQRLGRISKRGDRYFRYLLVHGARAVAAVIERHKD
FT                   NMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHHTEYRTLSAV"
FT   CDS             complement(193887..194678)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01981"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27983"
FT                   /db_xref="GOA:E7B0I9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I9"
FT                   /protein_id="CBY27983.1"
FT                   /translation="MLKLRRRSVHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTVCANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKTQPACQ
FT                   RVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAERVLKWR"
FT   CDS             complement(194852..196108)
FT                   /transl_table=11
FT                   /locus_tag="Y11_01991"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_01991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27982"
FT                   /db_xref="GOA:E7B0I8"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I8"
FT                   /protein_id="CBY27982.1"
FT                   /translation="MDFFRFLMSDVLSEPAVLVGLIALIGLIAQKKPVTECIKGTVKTI
FT                   MGFVILGAGAGLVVSSLGDFANIFQHAFGIQGVVPNNEAIVSVAQKSFGKEMAMIMFFA
FT                   MVINILIARFTPWKFIFLTGHHTLFMSMMVAVILATAGISGVTLIVIGSLVVGVAMVFF
FT                   PAIAHPYMKKVTGSDDVAIGHFSTLSYVLAGFIGSKFGNKEHSTEDMNVPKSLLFLRDT
FT                   PVAISFTMCIIFIVTCLFAGPEVVKSLSGGKNWFMFSLMQSITFAAGVYIILQGVRMVI
FT                   AEIVPAFKGISDKLVPNAKPALDCPVVFPYAPNAVLVGFLSSFAAGLIGMFALYMMNMT
FT                   VIIPGVVPHFFVGAAAGVFGNATGGRRGAILGAFAQGLLITFLPVFLLPVLGDIGFANT
FT                   TFSDADFGALGILLGIIVR"
FT   CDS             complement(196121..196408)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02001"
FT                   /product="putative sugar phosphotransferase component II B"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27981"
FT                   /db_xref="GOA:E7B0I7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I7"
FT                   /protein_id="CBY27981.1"
FT                   /translation="MKITVVCGNGLGTSLMMEISIKNILKELAVSAEVDHVDLGSAKGT
FT                   PSDIFIGTKDIAEQLVTQAVGGKIVALDNMIDKKAMKERLSVALTELGAL"
FT   CDS             complement(196451..196894)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02011"
FT                   /product="PTS system, IIA component, possible mannitol
FT                   permease"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27980"
FT                   /db_xref="GOA:E7B0I6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I6"
FT                   /protein_id="CBY27980.1"
FT                   /translation="MLKTLLTPDVIQVVSQAKDWRDAIAISCQPLIDNGSIEARYVEAI
FT                   YRSHEAIGPYYVVGPGIAMPHARPEEGANKLSLALTVLTEGVTFHAEGNDPVKLLIVLA
FT                   ATDSTSHIEAISQLAQLFDNDNDVQALLNAKTQQDILSVIARY"
FT   CDS             197050..198144
FT                   /transl_table=11
FT                   /locus_tag="Y11_02021"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27979"
FT                   /db_xref="GOA:E7B0I5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I5"
FT                   /protein_id="CBY27979.1"
FT                   /translation="MYCRGPVWEGFTQARILIKQEISMEKTRKRRNTGRVTLSDVANYA
FT                   GVGSMTVSRALRTPEQVSDKLREKIEQAVETLGYIPNRTAGALASGHSDTVAVLIPSLT
FT                   DKASSRFMQALQQILNKNEFQLLLGCHEYNQRKEAEILMTLLQSNPAAVVIFGSQLAEK
FT                   TYQLLERANIPTVNVVGSYFKGAKITLEAAFFESAYELSRHLLERGYHHIGFIGAHMDN
FT                   RLQRQQLNGWHKAMLEHYKNADQTVTTPETASLQFGRYALTEILQRQPELDAVICSHED
FT                   IALGVLFECQRRLLRIPSGIAVACLDGSDSCDQTYPTLTSMRIDYKKMGKEAGKMLIEL
FT                   LDNDDDGESLSQNFSYKFELRQST"
FT   CDS             complement(198725..200800)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02031"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27978"
FT                   /db_xref="GOA:E7B0I4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I4"
FT                   /protein_id="CBY27978.1"
FT                   /translation="MEQKGVRLSVFKPIAQPRAGNDAPDQTTTIIRANSSITAAEPLNM
FT                   NHVENLLSSNQQDVLMEEIVARYHENTKDAEVVLVEGLVPTRKHQFANALNYEIAKTLN
FT                   AEIVFVIALGNDSPDQLKERIELARSSFGGSKNKNITGVIINKLNAPVDEQGRTRPDLS
FT                   EIFDDSTKASVASIDPKQLFANSPLPVLGCVPWSFELIATRAIDMCKHLNARIINEGDI
FT                   RTRRVKSVTFCARSIPHMLEHFRPGSLLVTSADRPDVLVSACLAAMNGVEIGAILLTGG
FT                   YAIDEPIKKLCDRAFQTGLPVFMVDTNTWQTSLSLQSFNLEVPADDHERVEKLQNYVAS
FT                   HINSEWIDSLSATSERSRRLSPPAFRYELTELARKAGKRIVLPEGDEPRTVKAAAICAE
FT                   RGIATCVLLGNPEEIQRVAAAQGVELGKGVEIIDPVAVREQYVPRLVELRKSKGMTEVV
FT                   AREQLEDNVVLGTLMLEKGEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVFFML
FT                   LPDQVLVYGDCAINPDPTAEQLSEIAIQSADSAAAFGIEPRVAMISYSTGNSGAGSDVE
FT                   KVREATRLAQEKRPDLIIDGPLQYDAAIMADVAKSKAPNSPVAGKATVFIFPDLNTGNT
FT                   TYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTVALTAIQSAQADASAS"
FT   CDS             200799..200915
FT                   /transl_table=11
FT                   /locus_tag="Y11_02041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27977"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I3"
FT                   /protein_id="CBY27977.1"
FT                   /translation="MERMTPKLTLVKPTLVPVGINIIVRDTAKPLYGYALRP"
FT   CDS             complement(201159..202361)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02051"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27976"
FT                   /db_xref="GOA:E7B0I2"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I2"
FT                   /protein_id="CBY27976.1"
FT                   /translation="MSSKLVLVLNCGSSSLKFAIIDAANGEEHLSGLAECFHLPEARIK
FT                   WKLDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKFTASAI
FT                   VTEEVIQGIKDSIPFAPLHNPAHLIGIAEALKSFPNLADKNVAVFDTAFHQTMPEESYL
FT                   YALPYSLYKENGIRRYGAHGTSHFYVSQEAAKTLNKPLEELNVITCHLGNGGSVTAVRN
FT                   GKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLYDAMGMTMEQISKLLTKESGLLGLTE
FT                   VTSDCRYVEDNYETKADARRAMDVFCHRLAKYIGAYTALMDGRLDAVVFTGGIGENAAM
FT                   VRELTLDKLGLLGFEIDHERNLAARFGKSGTITKDGSRLALVIPTNEELVIAQDAARLT
FT                   A"
FT   CDS             202794..203249
FT                   /transl_table=11
FT                   /locus_tag="Y11_02061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27975"
FT                   /db_xref="GOA:E7B0I1"
FT                   /db_xref="InterPro:IPR007334"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I1"
FT                   /protein_id="CBY27975.1"
FT                   /translation="MTTKPSDSVSWFQVLQRGQHYMKTWPTDKRLAPVFPENRVATATR
FT                   FGIRFMPPLAIFTLTWQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQ
FT                   WFHEVRNKLAEAGQAVAPVEQTPTYQSLADVLKRAFKQLDKTFLDDL"
FT   CDS             203418..203912
FT                   /transl_table=11
FT                   /locus_tag="Y11_02071"
FT                   /product="upf0304 protein yfbU"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27974"
FT                   /db_xref="InterPro:IPR005587"
FT                   /db_xref="InterPro:IPR023145"
FT                   /db_xref="InterPro:IPR023146"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0I0"
FT                   /protein_id="CBY27974.1"
FT                   /translation="MDMTNAQRLILSNQYKMMTMLDPENAERYRRQQTIVERGFGLQMR
FT                   ELDRDFGEMSEDTCRTIINIMEMHHALQVSWDNLKDKQDLDERRIAFLGFDAATESRYL
FT                   SYVRFMVNTEGRYTHFDSGTHGFNSQTPMWDKYQRMLAIWQSCPRQYHLSAVEISQIIN
FT                   A"
FT   CDS             203959..204615
FT                   /transl_table=11
FT                   /locus_tag="Y11_02081"
FT                   /product="putative phosphatase YfbT"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27973"
FT                   /db_xref="GOA:E7B0H9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H9"
FT                   /protein_id="CBY27973.1"
FT                   /translation="MECKGFLFDLDGTLVDSLPAVERAWIGWAQSRGIDPSEVIEFIHG
FT                   KQAITSLRHFMLGASDAELQAEFLALEHIEANDTDGVTALPGAVLLLERLNSLSIPWAI
FT                   VTSGSVPVASARRTAGHLPEPKVFVTAEQVKHGKPMPDAYLLGAERLGLAPADCIVVED
FT                   APAGILSGLAAGCQVIAVNVPADTPKLNQVNLVLSSLEHIAVEKTANGAAVRFIG"
FT   CDS             complement(204806..205603)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27972"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H8"
FT                   /protein_id="CBY27972.1"
FT                   /translation="MIDITDYPIVLFLLSCALLYGSAYVGQAFFRRGRDLDDNIRENFT
FT                   VIQGATLTLLGLIIGFSFSMAISRYDLRKNYEEAEANAIGTEYLRVDYLPAASGVTTKA
FT                   LLIHYLDQRILFYTTRNENHLAEINDRTNQLENALWAELLGPVNQRPDPVMALVVSGMN
FT                   DVLNSAGYTQAAWWNRIPHAAWLLMLIIAICSCTLVGYGSKQGKKGKVMTLILPLVISF
FT                   SFMLIADIDSPRGGIIRVKPQNLHSLEGSLVPLPSEPSHPQSR"
FT   CDS             205692..205844
FT                   /transl_table=11
FT                   /locus_tag="Y11_02101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27971"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H7"
FT                   /protein_id="CBY27971.1"
FT                   /translation="MFPANFFTGEYGITNWLIIFQKKIQLIPLWDGKRINLQSLLISSS
FT                   GSVLI"
FT   CDS             205966..207801
FT                   /transl_table=11
FT                   /locus_tag="Y11_02111"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27970"
FT                   /db_xref="GOA:E7B0H6"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H6"
FT                   /protein_id="CBY27970.1"
FT                   /translation="MNSELLWVLTLLLIAIVLFTTNKLRMDVVALLVIIAFVMSGTLSL
FT                   GEATSGFSDPNVILIAALFVIGEGLVRTGVAYQVGDWLVKVAGHSETKMLALLMVTVAG
FT                   LGAFMSSTGVVAIFIPVVLSVASRMKISPGRLMMPLSFAGLISGMMTLVATPPNMVVNS
FT                   ELLREGIKGFGFFGVTPIGLIILLMGVGYMLVARHWLGGKPESSEKEQQWKRRTFRDLI
FT                   RDYKLTGRARRLAIRHDSPLIGRSLDELHLRARYGANVVGIERWKRFRRVMVSATGSSE
FT                   LHENDVLLIDMSDCDVDLREFCTEQMLEPMVLRGEYFSEQARNVGMAEVSLIPDSSLLG
FT                   KSLREVTFRTRYGLNVVGIRRNGKTLEGKLVDDKLQFGDILLVIGDWKLIRQLQQKTRD
FT                   FIVLNLPAEVDEVAPAISQAPHALFCLALMVAMMLTDEVPNVIAALVACLLMGQFRCID
FT                   MESAYRSIHWPSLILIIGMMPFAQALQKTGGVDLIVRGLMDVAGGMGPRVMLLCLFVLC
FT                   ATIGLFISNTATAVLMAPIAIAAAREMSLSPYPFAMIIGIAASAAFMTPVSSPVNTLVL
FT                   GPGGYKFGDFIRIGVPFTLLVMIVSVMVVPVLFPF"
FT   CDS             complement(208033..208626)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02121"
FT                   /product="nucleotidase YfbR, HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27969"
FT                   /db_xref="GOA:E7B0H5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR022971"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H5"
FT                   /protein_id="CBY27969.1"
FT                   /translation="MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAII
FT                   KNRKFNGNINADRIALLAMYHDASEVITGDLPTPIKYYNPQIAHEYKKIEKVAQQKLIE
FT                   MLPVELQHDFRCLLDEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKVRLEK
FT                   TLAMRQSPEMDYFMEVFVPSFSLSLDEISLDSLD"
FT   CDS             complement(209368..210582)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02131"
FT                   /product="aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27968"
FT                   /db_xref="GOA:E7B0H4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H4"
FT                   /protein_id="CBY27968.1"
FT                   /translation="MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAP
FT                   FGFDAPDEILVDVIRNLPTAQGYCDSKGLFSARKAIMQHYQARDMRDLTVEDIYIGNGV
FT                   SELIVQSMQALLNLGDEMLVPAPDYPLWTAAVSLSSGKAVHYMCDEESGWFPDLDDIRN
FT                   KITKRTRGIVIINPNNPTGAVYSKELLLEIVEIARQNDLIIFADEIYDKILYDEAQHHS
FT                   IAALAPDLLTVTFNGLSKTYRVAGFRQGWMVLNGPKNHAKGYIEGLEMLASMRLCANVP
FT                   MQHAIQTALGGYQSISEFIQPGGRLYEQRDRAWELINQIPGVSCVKPQGALYMFPRIDQ
FT                   KRFNLKDDQKLVLDLLLQEKVLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRKLGRFL
FT                   ETYHQ"
FT   CDS             211446..212378
FT                   /transl_table=11
FT                   /locus_tag="Y11_02141"
FT                   /product="lysr family transcriptional regulator lrhA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27967"
FT                   /db_xref="GOA:E7B0H3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H3"
FT                   /protein_id="CBY27967.1"
FT                   /translation="MTNANRPIINLDLDLLRTFVAVADLNTFASAAAAVCRTQSAVSQQ
FT                   MQRLEQLVGKELFARHGRNKLLTEHGLQLLGYARKILRFNDEACTSLMYSNVEGSLIIG
FT                   ASDDTADTLLPFLLNRVATLYPRLAIDVRVKRSPLIADMLSHGEADLAITTAKVDNHPH
FT                   VILRTSPTLWYCSADYQFQPGESVPLVVMDEPSPFRDMAIEHLTRAGIAWRIAYVASSL
FT                   SAIRAAVRAGLGITARPIEMMSPDLRVLGETEGLPRLPETHYSLCKDSRCSNELALAIF
FT                   DAMQTGYQHGLQSGTDLMLDSDYLVDDQN"
FT   CDS             213055..213546
FT                   /transl_table=11
FT                   /locus_tag="Y11_02151"
FT                   /product="NADH ubiquinone oxidoreductase chain A"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27966"
FT                   /db_xref="GOA:E7B0H2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H2"
FT                   /protein_id="CBY27966.1"
FT                   /translation="MSMSTTTEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARA
FT                   KNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAT
FT                   IFILVLLAGLVYLVRIGALDWTPVRSNRRVSKPSIVKYASNHPQAIPKDRGVESTATSK
FT                   "
FT   CDS             213668..214345
FT                   /transl_table=11
FT                   /locus_tag="Y11_02161"
FT                   /product="NADH-ubiquinone oxidoreductase chain B"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27965"
FT                   /db_xref="GOA:E7B0H1"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H1"
FT                   /protein_id="CBY27965.1"
FT                   /translation="MNYTLTRIDPNGENDRYPLQTQETVSGDPLEQHVHRSVYMGKLEN
FT                   AMHDMVNWGRKNSLWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADFMVVA
FT                   GTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDVYIPGC
FT                   PPRPEAYMQALLLLQESIGKERRPLSWVVGDQGVYLANMQPERERKHAERIAVTNLRTP
FT                   DEI"
FT   CDS             214485..216281
FT                   /transl_table=11
FT                   /locus_tag="Y11_02171"
FT                   /product="NADH-ubiquinone oxidoreductase chain C;
FT                   NADH-ubiquinone oxidoreductase chain D"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27964"
FT                   /db_xref="GOA:E7B0H0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0H0"
FT                   /protein_id="CBY27964.1"
FT                   /translation="MTDLTTSDSTQPAWQTRDHLDDPVMGELSNRFGPEAFVVQATRTG
FT                   MPVVWVKREQLLEVMSFLRKQPKPYVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSI
FT                   ERNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQTW
FT                   EGHPLRKDYPARATEFDPFVLTKQKEDLEMESLTFKPEDWGMKRGTENEDFMFLNLGPN
FT                   HPSSHGAFRIVLQLDGEEIVDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCV
FT                   NEMPYVLAVEKLAGIEVPDRVKTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFT
FT                   DRQKVYDLVEAITGFRMHPAWFRIGGVAHDLPRGWERLLRDFLDWMPKRLDSYVKAALQ
FT                   NSILKGRSIGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN
FT                   GDCYDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHF
FT                   LQVSWGPVMPANESFQMVEATKGINSYYLTSDASTMSYRTRIRTPSYAHLQQIPSVIRG
FT                   SLVSDLIVYLGSIDFVMSDVDR"
FT   CDS             216284..216847
FT                   /transl_table=11
FT                   /locus_tag="Y11_02181"
FT                   /product="NADH-ubiquinone oxidoreductase chain E"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27963"
FT                   /db_xref="GOA:E7B0G9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G9"
FT                   /protein_id="CBY27963.1"
FT                   /translation="MSNQKDTQVSNESQNVANLAVNAAEPATTAEVFELSAEERDAIEH
FT                   EKHHYEDARAASIEALKIVQKQRGWVPDGAIHAIAEVLGIPASDVEGVATFYSQIFRQP
FT                   VGRHVIRYCDSVVCHITGYQGIQAAISKKLSIQPGQTTFDGRFTLLPTCCLGNCDRGPT
FT                   MMIDDDTHSYLKPEDIEKLLEQYP"
FT   CDS             216844..218211
FT                   /transl_table=11
FT                   /locus_tag="Y11_02191"
FT                   /product="NADH-ubiquinone oxidoreductase chain F"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27962"
FT                   /db_xref="GOA:E7B0G8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G8"
FT                   /protein_id="CBY27962.1"
FT                   /translation="MTANSGFTKEIVRTPEMHPLTWRLRDDKQPVWLDEYRSKNGYVGA
FT                   EKALKSMAAPDVVSLVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPG
FT                   TYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVHLRRAIAEATEAGLL
FT                   GKNIMGSGFDFELIVHTGAGRYICGEETALINSLEGRRANPRSKPPFPASSGVWGKPTC
FT                   VNNVETLCNVPAILEHGVEWYQGITAGKSNDAGTKLMGFSGRVKNPGLWELPFGITARE
FT                   ILEDYAGGMRDGLKFKAWQPGGAGTDFLTADHLDLPMDFENIAKAGSRLGTALAMAVDH
FT                   EIGMVPLVRNLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRF
FT                   LGSGKTFCAHAPGAVEPLQSAIKYFREEFEAGIASKDYGNTRAIAGIQPNLLKARW"
FT   CDS             218640..221183
FT                   /transl_table=11
FT                   /locus_tag="Y11_02201"
FT                   /product="NADH-ubiquinone oxidoreductase chain G"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27961"
FT                   /db_xref="GOA:E7B0G7"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G7"
FT                   /protein_id="CBY27961.1"
FT                   /translation="MTPATDGTFISIDDGEAKAFRESVVEWLMTNHPHDCPVCEEGGNC
FT                   HLQDMTVMTGHSFRRYRFSKRTHQNQDLGPFISHEMNRCIACYRCVRYYKDYADGTDFG
FT                   VYGAHDNVYFGRTESGTLESEFSGNLVEVCPTGVFTDKTHSERYNRKWDMQFAPSICQQ
FT                   CSVGCNTSPGERYGELRRIENRYNGSVNHYFMCDRGRFGYGYVNRKDRPRQPQQLRGND
FT                   WIHLNAEQAMQGAADILRQAKKTIGIGSPRASLESNFALRELVGAENFYTGIAASEQQR
FT                   LQLMLKVLREGGIYTPALREIESYDAVLILGEDLTQTGARIALSVRQAVKGKAREMAAA
FT                   QKVADWQIAAIMNIGQHAKHPLFITNVDNTRMDDIAAWNYRAPVDDQARLGFAIAHALD
FT                   ESAPAVDDLAKELKGKVDIIVQALAGAKKPLIITGSSAGSDAIIEAAANVAKALKGRGS
FT                   DVGITFVASAANSIGLTMIGGGSLDQALESLTQGDADSVIVMENDLYRHAAKDKVDAAL
FT                   EKAANLIVVDHQRTAIMDKANLILSAASFAESDGTLVNQEGRAQRFFQVYDPTYYDDPK
FT                   KPESRSIMLESWRWLHSLHSTYTSRHVDWTQLDHVIAACVAALPQLEGIVEAAPDASFR
FT                   IRGQKLARSPIRYSGRTAMRADISVHEPRQPQDIDTPFAFSMEGNNSPLADRQQIPFAW
FT                   APGWNSPQAWNKFQAEVGGKLRFGDPGIRLIEAGEGTLGYFDSIPAAFTANGENWQIAP
FT                   YYHLFGSEEMSQRSDVIQQRMPAPYVMVNPADAARLGVNLGTLVEFNCAGQTLRLPVRL
FT                   SETLAQGQVGLPLGLPGIPPIMVGARVENLREAGL"
FT   CDS             221180..222157
FT                   /transl_table=11
FT                   /locus_tag="Y11_02211"
FT                   /product="NADH-ubiquinone oxidoreductase chain H"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27960"
FT                   /db_xref="GOA:E7B0G6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G6"
FT                   /protein_id="CBY27960.1"
FT                   /translation="MSWFTPELIEILISVLKAVVILLVVVTCGAFMSFGERRLLGLFQN
FT                   RYGPNRVGWGGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVS
FT                   PTWAVADLNIGILFFLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLS
FT                   LMGVVAQAGSFNMQDIVNSQEHVWNVIPQFFGFVTFAIAGVAVCHRHPFDQPEAEQELA
FT                   DGYHIEYSGMKFGLFFVGEYIGIVTVSALIVTLFFGGWQGPFLPPFIWFALKTAFFMVM
FT                   FILIRASLPRPRYDQVMSFGWKVCLPLTLLNLLATAAVILYNAQ"
FT   CDS             222172..222714
FT                   /transl_table=11
FT                   /locus_tag="Y11_02221"
FT                   /product="NADH-ubiquinone oxidoreductase chain I"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27959"
FT                   /db_xref="GOA:E7B0G5"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G5"
FT                   /protein_id="CBY27959.1"
FT                   /translation="MTLKELVVGFGTQVRSLWMIGLHAFHKRETQMYPEEPVYLPPRYR
FT                   GRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAEHKDGRWYPEFFRINFSRCIFCGL
FT                   CEEACPTTAIQLTPDFEMGEFKRQDLVYEKEDLLISGPGKYPEYNFYRMSGMAIDGKPK
FT                   GDAENEAKPIDVKGLMP"
FT   CDS             222727..223272
FT                   /transl_table=11
FT                   /locus_tag="Y11_02231"
FT                   /product="NADH-ubiquinone oxidoreductase chain J"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27958"
FT                   /db_xref="GOA:E7B0G4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G4"
FT                   /protein_id="CBY27958.1"
FT                   /translation="MEFAFYIAALVAVVATIRVITHTNPVHALLYLIISLLAISAVFFS
FT                   LGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGNVEQQERDWLKPSLWIGPGLLALVLLT
FT                   VLIYAISSVTDSGISGEMVDAKAVGISLFGPYVLAVELASMLLLAGLVVAFHIGREHKP
FT                   GEVLGASESAKRKTEEQA"
FT   CDS             223269..223571
FT                   /transl_table=11
FT                   /locus_tag="Y11_02241"
FT                   /product="NADH-ubiquinone oxidoreductase chain K"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27957"
FT                   /db_xref="GOA:E7B0G3"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G3"
FT                   /protein_id="CBY27957.1"
FT                   /translation="MIPLQHGLILAAILFVLGLTGLIIRRNLLFMLISLEVMINAAALA
FT                   FVVAGSYWGQADGQVMYILAITLAAAEASIGLALLLQLYRRRHTLNIDTVSEMRG"
FT   CDS             223568..225412
FT                   /transl_table=11
FT                   /locus_tag="Y11_02251"
FT                   /product="NADH-ubiquinone oxidoreductase chain L"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27956"
FT                   /db_xref="GOA:E7B0G2"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G2"
FT                   /protein_id="CBY27956.1"
FT                   /translation="MNLLYLTILLPLLGFLLLAFSRGRWSENTSATVGVGSIGLTALVT
FT                   LYVAVDFLSQKATGVQVFNQTLWNWMSVGTFNIPLTLTLDGLSLTMLSVVTGVGFLIHM
FT                   YASWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLMLMYLGWEGVGLCSYLLIGFYYTN
FT                   PANGAAAMKAFIVTRVGDVFLAIALFILYQELGTLNIRELMVLAPQKLEMGSTAITWAT
FT                   LMLLGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMAPE
FT                   VLHLVGIIGAVTLVLAGFAALVQSDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMT
FT                   HAFFKALLFLSSGSVILACHHEQNIFKMGGLRKTIPLVYICFLVGGAALAALPIVTAGF
FT                   YSKDEILWGALASGHINLMVAGLVGAFLTALYTFRMIFIVFHGEPKTKAHQVKGITHSL
FT                   PLIVLLVLSTFVGALITPPLAGVLPELHFGEEGKMPLEIFSGVLVVMGIALAAMLYLGK
FT                   RQLVNSIAQSAPGRFFTVWWFHAWGFDWLYHNVFVRPYLWIARLLQRDPLNSLMNTPAI
FT                   LSRWSNRGLTVSENGQVRWYVASMGLGAVVVLALLLFV"
FT   CDS             225431..226969
FT                   /transl_table=11
FT                   /locus_tag="Y11_02261"
FT                   /product="NADH-ubiquinone oxidoreductase chain M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27955"
FT                   /db_xref="GOA:E7B0G1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G1"
FT                   /protein_id="CBY27955.1"
FT                   /translation="MLLPWLILIPFIGGLLSWQCERFGTRVPRWIALLAMGLTLVLSLQ
FT                   LWVQGNYSLMNPAGIPQWQSEFTLPWIPRFGISFHLALDGLSLLMVVLTGLLGVLAILC
FT                   SWREIQRNQGFFYLNLLWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASD
FT                   GKTRIAAATKFFIYTQASGLIMLIAILGLVFVHYNATGIWTFNYEDLLKTPMSHNVEWL
FT                   LMLGFFIAFAVKMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPFFPN
FT                   ASAEFAPIAMWLGVIGIFYGAWMAFCQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQG
FT                   AVIQMIAHGLSAAGMFIICGQLYERLHTRDMRQMGGLWGRIKYLPALSLFFAVATLGMP
FT                   GTGNFVGEFMILFGSFQVVPVITVISTFGLVFASVYSLIMMQRAYYGAPKSEEALPGMS
FT                   ARELSIILLLVVLLVLLGVYPQPILDTSHAAMSNVQQWFSASSIPVPSITTTRP"
FT   CDS             226976..228433
FT                   /transl_table=11
FT                   /locus_tag="Y11_02271"
FT                   /product="NADH-ubiquinone oxidoreductase chain N"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27954"
FT                   /db_xref="GOA:E7B0G0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0G0"
FT                   /protein_id="CBY27954.1"
FT                   /translation="MTITPQQLIAMLPLLIVGLTVVVVMLSIAWRRDHFINATLTVIGL
FT                   NIALLSLYFVGQVGPMDVTPLMRVDGYAMFYTGLVIVASLATSTFAYPWLNGYPDNREE
FT                   FYLLVLIATMGGILLASANHLASLFLGIELISLPLFGLIGYAYRQKRSLEASIKYMLLS
FT                   AAASSFLLFGMALLYAESGSLSFAGLGKSLSDSMIHQPLILAGLGMMIVGLGFKLSLVP
FT                   FQLWTPDVYQGAPAPVSTFLATASKIAIFAVVMRLFLYAPAADSEAVRLVLSLIAVASI
FT                   LFGNLMAISQTNIKRLLGYSSIAHLGYLLIALVAVQTHQLALETAGVYLAGYLFSSLGA
FT                   FGVVSLMSSPYKGPDAESLFSYRGLFWHKPILSAVMTVMMLSLAGIPMTLGFIGKFFVV
FT                   AMGVSANLWWLTGAVVLGSAIGLYYYLRVTVSLYLSAPETLVRDTPSNWALTAGGVVVL
FT                   ISAILVLVLGIYPQPLISLVQLAQPLM"
FT   CDS             228637..229458
FT                   /transl_table=11
FT                   /locus_tag="Y11_02281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27953"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F9"
FT                   /protein_id="CBY27953.1"
FT                   /translation="MGLVSYVSRGIHAAKELINHDPKDKSFLKAKPEVFDWGEKNTIHR
FT                   LIGILNKKEDEKTVYDKNSVPIEIDKMLNKSKEHLYCFLLKAQKTEASCSYLIERSQCD
FT                   FVGGIAKERPETRLELVNFMKKYVVNEIIKRANLACENENSSHSRFINYGGLIIKGLEE
FT                   NISKLGESNEKIKLLTSGNGDEHISTDLTDYVNKHASYSVEPEIFYPLIIKYYESKAES
FT                   LCLPSMEELDTLINSVVKKIEDIKLLSDSEVAILLSNSAGGHTASHFHKLV"
FT   CDS             229602..230093
FT                   /transl_table=11
FT                   /locus_tag="Y11_02291"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27952"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F8"
FT                   /protein_id="CBY27952.1"
FT                   /translation="MNIILMIAITTGILSGIWGWVAVSLGLISWAGFLGCTAYFACPQG
FT                   GLKGLLITLLTCVSGVFWAMMIIQGSALQPEWAILGYVLTGLVAFLMCIQAYQQWLSFV
FT                   PGTFIGTCATFAGDGNWRLVIVSLLVGVVFGYAMKNSGLWLAAKRERQGRSSLESVGQD
FT                   "
FT   CDS             230130..230300
FT                   /transl_table=11
FT                   /locus_tag="Y11_02301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27951"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F7"
FT                   /protein_id="CBY27951.1"
FT                   /translation="MIGDRVQLIELLFRLLIVQLSLYLCCLNRAGGQAGPPAPAACAKY
FT                   CPAGKPPASLG"
FT   CDS             complement(230890..231357)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02311"
FT                   /product="protein YjgK, linked to biofilm formation"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27950"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F6"
FT                   /protein_id="CBY27950.1"
FT                   /translation="MILDELKSAVNNALYPDAIRRTLATINKMDLTNLPAGELDIEGRE
FT                   IYLNHIIASSKPLYEQAPELHRYYIDIHILLEGSEVIGASPSAQGQRPTMDFDTERDYG
FT                   LFEGITTETLLTLAPGDIALLFPGELHRPMGTLGDVASLRKIVVKVANHLL"
FT   CDS             complement(231398..231928)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02321"
FT                   /product="gluconokinase"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27949"
FT                   /db_xref="GOA:E7B0F5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F5"
FT                   /protein_id="CBY27949.1"
FT                   /translation="MSGKCIIVMGVSGTGKSCVGQALAQALNAKFIDGDDLHPRANIQK
FT                   MASGQPLNDSDRAPWLERLSDVAYSLQQKNEVGFLVCSALKKQYRDRLREGNQGVRFLW
FT                   LTGDYELVLRRMQQRAGHFMPESLLKSQFATLEAPDAREPDIIPIDISPDIAGVVKHCI
FT                   TALEPENNISHCA"
FT   CDS             complement(232141..232905)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02331"
FT                   /product="5-keto-D-gluconate 5-reductase"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27948"
FT                   /db_xref="GOA:E7B0F4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F4"
FT                   /protein_id="CBY27948.1"
FT                   /translation="MKNLFSLENRKVLITGSAQGIGFLLAKGLAEFGAEIIINDITAER
FT                   AEKAAAELRDSGFVAYAAAFNVTDHDAVNDAIAQIENNIGAIDILINNAGIQRRHAFTE
FT                   FPEKDWDDVIAVNQKSVFLVSQAVSRYMVKHQRGKIINICSMQSELGRDTITPYAASKG
FT                   AVKMLTRGMCVELARYNIQVNGIAPGYFKTDMTKALVDDKAFTDWLCKRTPAARWGDPE
FT                   ELIGAAVYLSSKASDFVNGHLLFVDGGMLVAV"
FT   CDS             233160..233276
FT                   /transl_table=11
FT                   /locus_tag="Y11_02341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27947"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F3"
FT                   /protein_id="CBY27947.1"
FT                   /translation="MLRQAVTTYVSDIALVTIKEDYLCGVGSSMGGRSGLTY"
FT   CDS             233408..234400
FT                   /transl_table=11
FT                   /locus_tag="Y11_02351"
FT                   /product="putative LacI-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27946"
FT                   /db_xref="GOA:E7B0F2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F2"
FT                   /protein_id="CBY27946.1"
FT                   /translation="MKNQRVTLQDIALLAGVTKMTVSRYLRTPEKVAPETGERIAQVMA
FT                   EVNYRADSEGETSLNQKSPRIGILVPSFNNQIFSDLLAGIESVTATSGYQTLVVNYNYN
FT                   KEREEEQIVNLLSCQISGLILTDSEHTLRADKYLNASELPVAQVMDLEPQFNRITVGFN
FT                   NYQAAYDMTATLLASGKQNVVYFGSMSDVRDRKRYQGYSQAMTDAGFAPLHITPNKVSS
FT                   VSIGAGMLALARQMYPQVDAIFCTNDDMAVGVLQECLKLGMAIPAEMAISGFHGLDIGQ
FT                   ATTPVLASVTTPRFEMGKVAAEILIKKIKKIPTIEQVDLHYRISLGGTI"
FT   CDS             234783..235304
FT                   /transl_table=11
FT                   /locus_tag="Y11_02361"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27945"
FT                   /db_xref="GOA:E7B0F1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F1"
FT                   /protein_id="CBY27945.1"
FT                   /translation="MKNSKPSSFKQAVLIIAPVMDYLTEKLEQNFTVHKLFEVTDTAEF
FT                   FAQQGENIKGIVTRGDIGVTNEVLTLLPEVQVISIFGVGTDAVDLDYTRERNIIVTTTP
FT                   GVLTDDVADTALGLIIATSRRLCQADKFLRAGQWPHSSLPLASKVTGKRLGVFGMGPHW
FT                   SSYCPPRCRF"
FT   CDS             235306..235749
FT                   /transl_table=11
FT                   /locus_tag="Y11_02371"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27944"
FT                   /db_xref="GOA:E7B0F0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0F0"
FT                   /protein_id="CBY27944.1"
FT                   /translation="MQIAYTDTAHIESLPYQHVPDLISLARQSDILVIAISGGKDSVGL
FT                   VDKTIFAAMPNHALLINIARGSMVNQDDLIRALQQKEIGGAGLDVFADEPNVPQALIEM
FT                   DNVVLLPHIASATIETRIQMSDIVFSNIQAHFAGEKAPTAITY"
FT   CDS             235924..237240
FT                   /transl_table=11
FT                   /locus_tag="Y11_02381"
FT                   /product="putative 2-ketogluconate transporter, ACS
FT                   family-MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27943"
FT                   /db_xref="GOA:E7B0E9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E9"
FT                   /protein_id="CBY27943.1"
FT                   /translation="MDSKIPNARWFRVIVPIMIACIISFMDRVNISFALPGGMESDLAI
FT                   TSQMAGLAGGIFFIGYLFLQVPGGRIAVHGSGRKFIAYSLAVWAVVSILTGFVTNHYQL
FT                   LFLRFVLGVSEGGMLPVVLTMVSNWFPEREIGRANAFVMMFAPIGGMFTAPLSGFIINA
FT                   LDWRWLFFLEGSLSAVVLIMWWFVISDRPEEAKWLSKKERDYLVTELARERAERMLDAP
FT                   VTNAPLKAVFLNKGLMKLVALNFFYQTGDYGYTLWLPTILKNLTDGNMASVGILAILPF
FT                   IATTAGIYVISSLSDKTGKRRLLIMISLFCFAAGLVTSVIFRHNVLVSYLALVVCGFFL
FT                   KAATSPFWSIPGRIAVPEVAGGARGVINGLGNLGGFCGPYLVGVMIFFYGQSAAVCMLA
FT                   GSLIIAGLITLTLPKECDVEVAAKGKGIADKGLTKVKRA"
FT   CDS             237302..237808
FT                   /transl_table=11
FT                   /locus_tag="Y11_02391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27942"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E8"
FT                   /protein_id="CBY27942.1"
FT                   /translation="MNLQQQLTLSQQHQQRLQLTHFNHEIAWQLGEKIKQQAERQGLAL
FT                   AINIRVNGQTLFSYAMLGTSAENVDWLRRKRNVVELLGTSSYTAGLMLQQRQTSLEERY
FT                   GVSLRDYAALGGGFPLQVKQAGIIGSVNVSGAPHLDDHNLLLQVLADFIGLPAGSIELL
FT                   APLTE"
FT   CDS             237818..239629
FT                   /transl_table=11
FT                   /locus_tag="Y11_02401"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27941"
FT                   /db_xref="GOA:E7B0E7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E7"
FT                   /protein_id="CBY27941.1"
FT                   /translation="MNPTLTRVTQRIIARSAPTRTAYLQRISTAKENTVHRSQLACGNL
FT                   AHGFAACQPEDKVSLKNMVRSDIAIITSYNDMLSAHQPYEHYPQQLKDALHQVGAVGQV
FT                   AGGVPAMCDGVTQGQDGMELSLMSRDVIAMSAAIGLSHNMFDGALYLGVCDKIVPGLLM
FT                   AALSFGHLPAVFVPAGPMASGLSNKEKVRVRQLYAEGKVDRHALLEAESASYHSAGTCT
FT                   FYGTANSNQMVMEVMGLHLPGSSFIQPNTPLRDALTAAAARQVTRLTQTSGNYLPVGQL
FT                   VDEKVVVNGIVALLATGGSTNHTMHLVAMARSAGIIIDWDDFSELSEVIPQLCRIYPNG
FT                   PADINYFQAAGGVALLIQELLQGGLLHEDVHTVVGFGLQRYTQEPYLGAGQLQWRSGPE
FT                   GSLDDSVIASLSKPFSPHGGTKVLSGNLGRAVMKTSAVPHDHQIIEGPAVVFDSQHDVG
FT                   PAFESGALDRDCVVVVRYQGPRAIGMPELHKLMPPLGVLLDRGFKVALVTDGRLSGASG
FT                   KVPSAIHVTPEAYCGGLLAKIRNGDRVRVDGVSGELSLLVDEAELATRHLALPDISAFH
FT                   VGCGRELFAALREQLTGAEQGACCIRF"
FT   CDS             239846..240154
FT                   /transl_table=11
FT                   /locus_tag="Y11_02411"
FT                   /product="elab protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27940"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E6"
FT                   /protein_id="CBY27940.1"
FT                   /translation="MNRDKEQQTSLDDDLTMLTDTLEEVLRASGDAADETYQEIKARAE
FT                   KALKEVQNRLSGRSECYIKRAKALACCTDDYVHDKPWCSVGIGATVGLVVGLLLARR"
FT   CDS             240388..241752
FT                   /transl_table=11
FT                   /locus_tag="Y11_02421"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27939"
FT                   /db_xref="GOA:E7B0E5"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E5"
FT                   /protein_id="CBY27939.1"
FT                   /translation="MKQLSGLLGELRQKLRANFPDQAGIRQIILPAPGQVGNQLLEWLS
FT                   AQYHFPQFYWCHREGHEEAAVCGQTRQFNDVQSADQFIQQHRAVAGLRVWGLNAFEPVS
FT                   IVEPSPDSSQQTQTSFLFLPRIEILRRGKNTYLTLNLVSDDSLAQDALLAIAFIDQLVA
FT                   AKPLPAVDVVVEAASHMPEYPQWSRLIEQALGNIEQQKMEKVVLARTTRLMLDKPLLCG
FT                   AFMAASRQVNHHCFHFMLRFDGLRAFLGSSPERLYLRQFQHLETEALAGTASNDDDTAQ
FT                   AAELADWLMHDEKNQRENLLVVDDICQRLQGGVAAVDVMPPEVIRLRKVQHLRRCIHAQ
FT                   LNHANDADCLHRLQPTAAVAGLPRNVARQFITENEPFSRGWYAGSAGYLSLKQTEFSVT
FT                   LRSAWVEDKQIHLYAGAGIVAGSDAEQEWQEINNKSAGLRTLLVNIKSDNNHKMQ"
FT   CDS             241843..241962
FT                   /transl_table=11
FT                   /locus_tag="Y11_02431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27938"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E4"
FT                   /protein_id="CBY27938.1"
FT                   /translation="MQTGFIVDNGKNLTINQSLRAFSADSLVPHVDYRGRSVC"
FT   CDS             241981..243654
FT                   /transl_table=11
FT                   /locus_tag="Y11_02441"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid
FT                   synthase"
FT                   /EC_number="2.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27937"
FT                   /db_xref="GOA:E7B0E3"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E3"
FT                   /protein_id="CBY27937.1"
FT                   /translation="MSTSVFNRRWAALLLEALSRHGVQHICIAPGSRSTPLTLAAAANP
FT                   SLVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAAANLYPALIEAGLTGERLILLT
FT                   ADRPPELIDCGANQAIRQPGMFASHPTVSLNLPRPTPDIPASWLVSTIDSAMAQLRHGG
FT                   LHVNCPFAEPLYGGDEQCYADWSATLGDWWQDCHPWLRQSRPLPQIEQADWLFWRQKRG
FT                   VVIAGRMTAEEGEQLAQWAELLGWPLIGDVLSQTGQPLPCADLWLAHPDAQRVLAQAQI
FT                   VLQFGSSLTGKRLLQWQAQCQPQEYWLVDNIAGRLDPVNHRGRRIISPVNEWLEQHPAL
FT                   RRTPWASELIIWSENAYAHVEQALNEQFSEAAVAHRLAELLPENGQLFVGNSLIVRLID
FT                   ALGQLPAGYPVYSNRGASGIDGLLSTAAGVQRATAKPTLAIVGDLSALYDLNALALLRQ
FT                   SSAPTVLLVVNNNGGQIFSLLPTPEADRQRFYCMPQNVSFEHAAAMFGLGYSRPESGLM
FT                   LKQQVDQCWLRGGVTLIEIEVPPSQGAETLQQLVQQVAQL"
FT   CDS             243651..244475
FT                   /transl_table=11
FT                   /locus_tag="Y11_02451"
FT                   /product="2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate
FT                   synthase"
FT                   /EC_number="4.2.99.20"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27936"
FT                   /db_xref="GOA:E7B0E2"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E2"
FT                   /protein_id="CBY27936.1"
FT                   /translation="MTLACRKLDPHPQSPARQHTGPWLVWLHGLLGSGQDWLPVAELCG
FT                   DYPSVLIDLPGHGNSVALTATGFEDISRQISETLQANGIREYWLAGYSLGGRIAMYHAC
FT                   YGHKVGLQGLLVEGGNLGLESDELRAARFEQDCQWAQRFRHEPLPQVLADWYQQDVFAD
FT                   LDSQQREQLVAVRANNHGPAVADMLEATSLGHQPWLLPALQCLSVPYSYLCGERDHKFQ
FT                   QLAHQYKLPLRTLARAGHNAHRANPGAFAALVLSFLSQSSFLPLSSFLPPSR"
FT   CDS             244489..245346
FT                   /transl_table=11
FT                   /locus_tag="Y11_02461"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27935"
FT                   /db_xref="GOA:E7B0E1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E1"
FT                   /protein_id="CBY27935.1"
FT                   /translation="MLYPSQEQLYAAIEWQDCSAGFEDIRYHKSSDGIAKITINRPHVR
FT                   NAFRPLTVKEMIQALADARYDDNIGVIILTGEGEKAFCSGGDQKVRGDYGGYQDASGTH
FT                   HLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTVAADNAIFGQTGPKVGSFD
FT                   GGWGAAYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLVDLEKETVRWCREML
FT                   QNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTDEGQEGRNAFNEKRQPDFSKF
FT                   KRNP"
FT   CDS             245346..246317
FT                   /transl_table=11
FT                   /locus_tag="Y11_02471"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27934"
FT                   /db_xref="GOA:E7B0E0"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0E0"
FT                   /protein_id="CBY27934.1"
FT                   /translation="MRAATLYRYSIPMEAGVILRHQRLKSRDGLLVKLQQGEQTGWGEI
FT                   APLPEFSEETLPEAQAAAIAELQRWVNGEELDLGPLPSVAFGLSCALAELEKLLPLSAD
FT                   YRKAPLCTGDPDELFGVLQALPGEKVAKVKVGLYEAVRDGMIVNVLLEALPDLTLRLDA
FT                   NRSWTRAKADGFAKYVNPELRSRIAFLEEPCKTRAESREFARDTGIAIAWDESVREADF
FT                   QVEAEPGVAAIVIKPTLVGSIVRCQQLVQQVHQAGLVAVISSSIESSLGLTQLARLADW
FT                   LTPATVPGLDTLSLMQAQCVRQWPDSTLPVVAVDQLDVLWHS"
FT   CDS             246305..247699
FT                   /transl_table=11
FT                   /locus_tag="Y11_02481"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27933"
FT                   /db_xref="GOA:E7B0D9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D9"
FT                   /protein_id="CBY27933.1"
FT                   /translation="MAQLNNWPWKDIFPWQHWANLQPRATAIRSGAQRISWQQLATDID
FT                   NLAAGFQQQGVTPGCGVVLRGKNSYSLLLAYLAALQCAARVLPLNPQLPESLLTQLLPQ
FT                   LDIDFMLNLAEPLPAALSFIPLDITTDNGAPHGVSWDSQRLATMTLTSGSSGLPKAAVH
FT                   TLAAHLASADGVLRLMDFTANDCWLLSLPLFHVSGQGIVWRWLSAGAALAVQAGVLLSD
FT                   ALVGCSHASLVPTQLWRLLESSGQLLSLKEVLLGGATIPTALTEQAAARGILCWCGYGL
FT                   TESASTVCAKRADGLPGVGVALEGRQVKLVEGEVWVKAACLAAGYWQQRQLQPLTDSDG
FT                   WFHTRDRGEWQQGELRILGRLDNLFFSGGEGIQPEDIERVLLQYPGVQQAFVIPVADTE
FT                   FGHRPVAVIDADEAVDATDLAHWLAPQLAVFQRPVAFYRLPAELKTGGIKVSRRGVFDF
FT                   VDKLSW"
FT   CDS             complement(247774..247896)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27932"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D8"
FT                   /protein_id="CBY27932.1"
FT                   /translation="MGKDAHRAGSSARVTQAVYPQGNISRKPQVQEGRLALLLG"
FT   CDS             complement(248349..249788)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02501"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27931"
FT                   /db_xref="GOA:E7B0D7"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D7"
FT                   /protein_id="CBY27931.1"
FT                   /translation="MSKKKGLTTAAGAPVVDNNNVITAGRRGPMLLQDVWFLEKLAHFD
FT                   REVIPERRMHAKGSGAYGTFTVTHDITRYTRAKIFSEIGKQTEMFVRFSTVAGERGAAD
FT                   AERDIRGFAMKYYTEEGNWDLVGNDTPVFYLRDPLKFPDLNHVVKRDPRTNLRNPTYKW
FT                   DFFSQLPESLHQLTIDFSDRGLPKSYRHMHGFGSHTFSFINAANERFWVKFHFRCQQGI
FT                   ENLMDDEAEKLVGQDRESSQRDLYEAIERGDFPRWNLQIQVMPEHEASQTPYNPFDLTK
FT                   VWPHGDYPLIDVGFFELNRNPENYFAEVEQASFNPANVVPGVSFSPDRMLQGRLFSYGD
FT                   AARYRLGVNHHQIPVNSAKCPFHNYHRDGAMRFDGNSGNTATYEPNSFGLFQEQPDFSE
FT                   PPLTLEGAADHWNHREDDDYYSQPRALFNLLSAEEHQRMFTRIAGELSQVPEEIQRRQI
FT                   ALFEKVHPNYGAGVKKALGLK"
FT   CDS             250146..250688
FT                   /transl_table=11
FT                   /locus_tag="Y11_02511"
FT                   /product="putative exported protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27930"
FT                   /db_xref="GOA:E7B0D6"
FT                   /db_xref="InterPro:IPR009998"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D6"
FT                   /protein_id="CBY27930.1"
FT                   /translation="MKKHLIACAASLLFVAGSANAISLNGEVGSDYTNLGFGMGTNTGG
FT                   LAISGNWARSDHDGDIYGLGLGFNLPLGPLMATIGGKGIYMSPEDGSSGGAVAIGGGLT
FT                   YPISKSFTLYGEGYFAPEELTSGMKSYSEANGGLRWNVFRPLTVDVGYRYINMKGKDGH
FT                   RDNRVADGVYIGAGLAF"
FT   CDS             complement(250886..252094)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02521"
FT                   /product="tyrosine-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27929"
FT                   /db_xref="GOA:E7B0D5"
FT                   /db_xref="InterPro:IPR002091"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D5"
FT                   /protein_id="CBY27929.1"
FT                   /translation="MKNRTLGSIFIVAGTTIGAGMLAMPLAAAGVGFGVTLALLVFLWL
FT                   LMCYTALLLVEVYQHEAADTGLGTLAKRYLGNRGQWLTGFSMMFLMYALTAAYISGAGE
FT                   LLATSISQWTQQSFPTSLGVLLFTLVAGGVVCIGTHSVDLFNRILFSAKIIFLIVMLAL
FT                   MMPHIEKTNLLTLPLEQGLALSAIPVIFTSFGFHGSVPSIVNYMGGNIRKLRWVFIIGS
FT                   AIPLIAYIFWQLATLGAISSHTFVGILAQQAGLNGLLQAVRDVVASPHVELAVHLFADL
FT                   ALATSFLGVALGLFDYLADLFKRRNSVRGRLQTGAITFVPPLLFALFYPRGFIMALGFA
FT                   AVALSVLALILPAMLAWKARKIHQGNYRVWGGKPALAAVFACGVLVIGIQVGIVTGTLP
FT                   AVG"
FT   CDS             252448..253650
FT                   /transl_table=11
FT                   /locus_tag="Y11_02531"
FT                   /product="competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27928"
FT                   /db_xref="GOA:E7B0D4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D4"
FT                   /protein_id="CBY27928.1"
FT                   /translation="MIRVEMLSTGDEVLHGQIIDTNAAWLADYLFNQGLPISSRETVGD
FT                   SLSALIEVLTERSQVADVLIVNGGLGPTSDDLSALAAARAAGTELIEHPEWIARMEAFF
FT                   QERGRVMSSTNRKQAHIPANAEMLDNPVGTACGFALRLNKCLMFFTPGVPSEFKVMVEQ
FT                   QIMPRLRQHFDVAEPPLCLRMTTFGRSESDLALELDSLSLPDGAVLGYRSSAPIIELKL
FT                   TGPASQQSAMEEVWQQARAVAGESMIFEGTRGLPALLSEQLTQRGLLLAVSEQFTAGLL
FT                   HWQLQSAAAPLAGGELLPAHCQESLAEVAGRAQSLSMLCGAQVVLAVSAMQNDCLSVAL
FT                   HTPEGTFAQTVRYQASRHGLRIRQESSAMLALDMLRRWLKGSPICGQHGWLNVVDILSL
FT                   N"
FT   CDS             253885..254655
FT                   /transl_table=11
FT                   /locus_tag="Y11_02541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27927"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D3"
FT                   /protein_id="CBY27927.1"
FT                   /translation="MNKFIVRCLMPLLKAILLIISPLVFAENRPGFVCGKFNGHVMEVP
FT                   DSYIIYWAEYEGASAWDPDFINNKKGCDANFVVLPMIASWPDMQPGDESKWYEQGLEYE
FT                   GLVISVRPFRRTDTDMTYKREFYLKKSPDKIFDPRIYIDDLGLFFVKATTKLNRGPAPD
FT                   KNDPDWPYWFDENINGYYWSEVEGRVPVVFDCRWLPLEKRYYICDALFVMPEIGSLVEV
FT                   SFTPEKLPQWQAIVRNTQQFLLSHIKNKEHNRVP"
FT   CDS             254690..255418
FT                   /transl_table=11
FT                   /locus_tag="Y11_02551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27926"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D2"
FT                   /protein_id="CBY27926.1"
FT                   /translation="MLVIALLIISPLSLAENRPGFVCGKFNGHVMEVPDSYIIYWAEYE
FT                   GASAWDPDFINNKKGCDANFVVLPMIARWPDMQPGDESKWYEQGLEYEGLVIGVEPFRR
FT                   SDTDIAFMRDAFLRKHKDKIFEPAIYINDLGLFFVKATTKINRFPPVEKNDPYRFDEKI
FT                   NGYYWSEVEGRVPVVFDCLWLPLEKRYYLCDALFVMPEIGSLVEVTFTIEKLPQWQAIV
FT                   RNTRQFLLSHIKNKEHNRVP"
FT   CDS             255453..256169
FT                   /transl_table=11
FT                   /locus_tag="Y11_02561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27925"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D1"
FT                   /protein_id="CBY27925.1"
FT                   /translation="MLVIALLIISPLSLAENRPGFVCGKFNGHVMEVPDSYIIYWAEYE
FT                   GLSSWTPGFTKNKKGCDANFVSLPMIARWPDMQPGDESKWYEQGLEYEGLRISVRPFRR
FT                   TDTDITYKREFYLKKSPDKIFDPMIYIDDLGLFFVKATTKLNRGPAPDKNDPDWPYWFD
FT                   ENVNGYYWSEVEGRVSVVFDCLWLPLEKKYYICESHFVMPEIGSLVRVVFTIDKLPQWQ
FT                   AIVRNTRQFLLSHIKR"
FT   CDS             256181..260023
FT                   /transl_table=11
FT                   /locus_tag="Y11_02571"
FT                   /product="calcium-dependent protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27924"
FT                   /db_xref="GOA:E7B0D0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0D0"
FT                   /protein_id="CBY27924.1"
FT                   /translation="MLQLKINAGELQLNAADLACARQLLESHQESKNPGPMYDFLASKG
FT                   DRYAVLANGVARGDSIAGAMAIHYLESVAESHDRPITETRLNNIRYDMARGYLAMQQSR
FT                   LDENPVGIIYGDINHEQATWFHNRAFRDHRLPSKAWTLDAVLRAIDEKSRPAYWEQVLN
FT                   AAGKPKEELLLSADTYQKMALSAKVGPDGIQQSSREWFDRVDSLAGYWALVKSSSSQLF
FT                   SSDEAAALSAAECNFNINISATPQTVERVADEDQVQRDIANGYLVNKPTHSFSFTDGTL
FT                   NNTDFISVQMGSMASGGIRPGAVQLDPNVQPSRYLSDYYLERPSYMLPEAGLFDAATIN
FT                   GLSAQTTVNTYVDPLLLDLSGQGVTMTGIEDGVLFDTDNSGTLKRTGWAGPASGMLVID
FT                   NGSGKIDNISQMYSEYYAGAAGVNGQPGQKRFQDGFAALASEDADGNGAIDRHDPIWHK
FT                   LRIWLDISHNGKVDPDELKTLDQWRITQIKVKASPVENDNRNGNRVVARGVFTIIGRQH
FT                   EVLAVNFASSPVSNRIIKRDAYGAFIHSGSGEATTTAYAQLTNRHRVLSANRLKVSNLY
FT                   GGSGNDVLKAGTQGSWLVGRGGSNTYVGNRGDDVFVISASDDPKNIKGNGGRDTVLIVG
FT                   KKAVTLNMARSGVTLAQGGDGDDVIISGGNNSVFIKGGRGNTTLVGGDGDDVLAGGIGK
FT                   NTIIGGSGKAVIYAGPQGDTIYAAEQGSIIHAGGGADKIYGGKGNDVIEAGQGNALIDG
FT                   GGGINVVSLHGTHADYIITRTASGYQIRDKVAGRDGTLALKNIQKLNFSDISAIDLQED
FT                   TIVPIDDVLTTNWHGKPLIRSDVHLIRGANLLANDLRFNDKSVLRISAVSDAVGGRVRL
FT                   SAAGNIVFFPDTRFTGVMSFKYQVMNTTGDTAISVVNLASGEVATKKAMVTLLSPDIPI
FT                   DPMVSQQQYLSETNVIPVWQDYTGKGIRIGQFEPGGEFATGPEIFDIQHSDLAANVDPA
FT                   WLATQKKTGELPAEISKHATMVAGVMVAARNNTGGVGVAYDATLGGHYLSNNGSDLTTL
FT                   GKMSSYDVVNHSWSSKPDFALSHTEGGALNLPNTLKTVMHYAAANGRGGLGTVIVTAGG
FT                   NQREQGGSAQGSLISHTRFGIQVGAINTPADLSTLQTRSLPFSNPGASLLVSAPGSRVL
FT                   SSSHQIKAERGAIFGSEYSTEQGTSFAAPIVSGVAALMLQANPNLGYRDVQQILALSAR
FT                   RVKDSASQWRTNSATGWNGGGMHVSHDYGFGRVDARAAVRLAETWTSKNTDANQQ"
FT   CDS             260099..261604
FT                   /transl_table=11
FT                   /locus_tag="Y11_02581"
FT                   /product="calcium-dependent protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27923"
FT                   /db_xref="GOA:E7B0C9"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C9"
FT                   /protein_id="CBY27923.1"
FT                   /translation="MASGLNVEQVEVDFSANVGRLGDLTIKLISPSGSESVLLDRAGKK
FT                   PVPNNADMGSTLFGEFNYTFMSTHHRGEHSAGQWRLEVQDAKNGLPIKPNSWSLRLFGH
FT                   KSTADDVYFYTDEFFDQVAEQPTRAILNDAVNGVAGGRNTLNAAAISGAVKINLVTGEA
FT                   NLGGTTLTINSPQTIHNIVSGDGNDVLTAGRNNSLLDGGRGRNTLVGGAGKEIFVVRKN
FT                   AGGHDSIINFEADKGEVINLVGFAEKKFSELQLSQQQDDVRIQFADKQIIIIKNRQIAA
FT                   LQAQHFNFQDTFIAPASYVDSRISMDKPVRKQTDILLKGGGGGIALRTDAKGKMVASLE
FT                   GAVYQRENAESSTFVVVFQEGESDYRNTVRGFRHGIDKIDLSGMNIRNFSELSVTKRNA
FT                   VVIHGLALIQGVDIKLTAANPEGKNISLMYLDGLDVEQLDAQDFIFADAQPMPADAPFI
FT                   EADIAPLMTAMSNVDRPDRESESFYSPTKISPSLSHSLTASSY"
FT   CDS             complement(261691..262197)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02591"
FT                   /product="proteinase inhibitor I11, ecotin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27922"
FT                   /db_xref="GOA:E7B0C8"
FT                   /db_xref="InterPro:IPR005658"
FT                   /db_xref="InterPro:IPR023084"
FT                   /db_xref="InterPro:IPR023189"
FT                   /db_xref="InterPro:IPR027438"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C8"
FT                   /protein_id="CBY27922.1"
FT                   /translation="MKRLSIAITSLLMAASASTIAATEPPLNQQQPLEKIAPYPQAEKG
FT                   MSRQVIFLEPQEDESRFKVELLIGKTIEVDCNRHMLSGNLETRTLSGWGFDYLVMDKIS
FT                   EPASTMMACSDNTRRPQFIAANLGEAAMQRYNSRLPIVVYVPQGVDVKYRIWQAGEEVR
FT                   NAQVK"
FT   CDS             complement(262568..262873)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02601"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27921"
FT                   /db_xref="GOA:E7B0C7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C7"
FT                   /protein_id="CBY27921.1"
FT                   /translation="MTWVSDGSQHRCNLKDDGDIVKLSTTGAQLNCPANSRNLLETLEY
FT                   HQIPIEYQCRSGYCGSCRLRLLKGEVCYQQQPLAFIQTGEILPCCCQPKGDIEIEL"
FT   CDS             complement(262953..264083)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02611"
FT                   /product="ribonucleotide reductase of class Ia
FT                   (aerobic),beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27920"
FT                   /db_xref="GOA:E7B0C6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C6"
FT                   /protein_id="CBY27920.1"
FT                   /translation="MAYTTFSQNKNNQLLEPMFFGQSVNVARFDQQKHAIFEKLIEKQL
FT                   SFFWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPE
FT                   LETWVETWSFSETIHSRSYTHIIRNIVNDPSIVFDDIVTNEEILKRAKDISAYYDDLIE
FT                   MTSYYHLLGEGTHQVNGKTVVVNLRELKKQLYLCLMSVNALEAIRFYVSFACSFAFAER
FT                   ELMEGNAKIIKMIARDEALHLTGTQHILNLMRSGEDDPEMAEIAEECQQQCYDLFVLAA
FT                   QQEKEWAEYLFRDGSMIGLNKEILCQYVEYITNIRMQAVGLGVPFNTRTNPIPWINSWL
FT                   VSDNVQVAPQEVEVSSYLVGQIDSEVSADDLSDFEL"
FT   CDS             complement(264169..266454)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02621"
FT                   /product="ribonucleotide reductase of class Ia
FT                   (aerobic),alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27919"
FT                   /db_xref="GOA:E7B0C5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C5"
FT                   /protein_id="CBY27919.1"
FT                   /translation="MNQSLLVTKRDGSKERINLDKIHRVIDWAAEGLHNVSVSQVELRS
FT                   HIQFYDGIKTADIHETIIKAAADLISRDAPDYQYLAARLAIFHLRKKAYGQFEPPKLFA
FT                   HVTKMVEMGKYDKHLLEDYTAEEFEQMDTFIDHWRDMNFSYAAVKQLEGKYLVQNRVSG
FT                   EIYESAQFLYILVSACLFSNYPRETRMDYIKRFYDAISTFKISLPTPIMSGVRTPTRQF
FT                   SSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALGSPIRGGEAFHTGCIPF
FT                   YKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDYGVQIN
FT                   KLMYQRLLKGEDITLFSPSDVPGLYDAFFADQDEFERLYTQYEQDASIRKQRVKAVELF
FT                   SLMMQERASTGRIYIQNVDHCNTHSPFDPKVAPVRQSNLCLEIALPTKPLNDINDENGE
FT                   IALCTLSAFNLGAIDSLDDLEDLAVLAVRALDALLDYQDYPIAAAKRGAMGRRTLGIGV
FT                   INFAYYLAKNGVRYSDGSANNLTHRTFEAIQYYLLKASNALAREQGACQWFNETTYSQG
FT                   ILPIDTYKKDLDTISDEPLHYDWETLRKDIQTHGLRNSTLSALMPSETSSQISNATNGI
FT                   EPPRGYVSIKASKDGILRQVVPEYERLKDAYELLWDMPNNDGYLQLVGLMQKFVDQAIS
FT                   ANTNYDPTRFPSGKVPMKQLLKDLLTTYKFGVKTLYYQNTRDGADDVQEDIQSQPGDDD
FT                   CEGGACKI"
FT   CDS             complement(266971..267699)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02631"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27918"
FT                   /db_xref="GOA:E7B0C4"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C4"
FT                   /protein_id="CBY27918.1"
FT                   /translation="MCADATALNQNVDEQEIAKFEAVASRWWDLEGEFKPLHRINPLRL
FT                   NYILQRAGGIFDKKVLDVGCGGGILAESMAREGAQVTGLDMGYEPLQVARLHALETGTK
FT                   LDYVQETVESHAQKHPQYYDVVTCMEMLEHVPDPASVIRACAQLVKPGGHVFFSTINRN
FT                   TKSWLMAVVGAEYVLKMVPKGTHDAKKFIRPSELIGWVDQTPLRERHIIGLHYNPITDH
FT                   FKLGRNVDVNYMVHTQRDEA"
FT   CDS             267903..270560
FT                   /transl_table=11
FT                   /locus_tag="Y11_02641"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27917"
FT                   /db_xref="GOA:E7B0C3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C3"
FT                   /protein_id="CBY27917.1"
FT                   /translation="MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLYAMNVLGNDWNKPYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSVDGDSAAAMRYTEIRMSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTKI
FT                   PNLLVNGSSGIAVGMATNIPPHNLSEVIDGCLAYIEDENITIEGLMEYIPGPDFPTAAI
FT                   INGRRGIEEAYRTGRGKVYIRARAEVEADAKTGRETIIVHEIPYQVNKARLIEKIAELV
FT                   KEKRVEGISALRDESDKDGMRIVIEIKRDAVGEVVLNNLYSLTQLQVTFGINMVGLSQG
FT                   QPKLLNLKDILVAFVRHRREVVTRRTIFELRKARDRAHILEALAIALANIDPIIELIRR
FT                   AATPAEAKAGLIASPWELGNVAAMLERAGGDAARPEWLEAEFGIRDGKYYLTEQQAQAI
FT                   LDLRLQKLTGLEHEKLLDEYKELLTVIAELIFILENPERLMEVIREELVAIKELYNDAR
FT                   RTEITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEED
FT                   FIDRLLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAIL
FT                   PVREYEEGRHIFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDLTDGTNEV
FT                   MLFSALGKVVRFPESQVRSMGRTATGVRGINLNGDDRVISLIIPRGDGEILTVTENGYG
FT                   KRTAVEEYPTKSRATQGVISIKVSERNGKVVGAVQVAPTDQIMMITDAGTLVRTRVSEV
FT                   SVVGRNTQGVTLIRTTEDEHVVGLQRVAEPEEDDNILEGESLEGEEGSEENTALNAPED
FT                   EDAADEAEDDDNNV"
FT   CDS             270678..273545
FT                   /transl_table=11
FT                   /locus_tag="Y11_02651"
FT                   /product="two-component sensor protein RcsC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27916"
FT                   /db_xref="GOA:E7B0C2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR019017"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C2"
FT                   /protein_id="CBY27916.1"
FT                   /translation="MKYLSSFRTTLKISRYLFRVLAVMLWSLGALLTTFYILNILNEKK
FT                   SDIRQEYNTNFEQAQNYIRHSSDIIRDIKYMAENRLNHNTASSDIAAGAFIKNKTTPKY
FT                   YPLNSEADCAILNLSRHSSLDSLSNLILYWKENFAAAYDLNRIFFIGSDTMCMVDFDIR
FT                   NVPMEQESLLKSLSEHIARYREANNQDKDDPLYWIVPGVRPEIGTLYVLSPLYVGNKLE
FT                   ALVGTEQTIRLEDFISSGPLPIGVTLLDQNNEPVLRLATGERYASMLDDYPDTPSYFGY
FT                   VDDYNYLLLKKNLLPSPLSIAYSLPVKTIIEIFKLLIFNALLLNALSAVVIFTLAWLFE
FT                   RKMFHPAEDNALRLEEHEQFNRKIVASAPVGISILRISDGTNILSNELAHNYINLLTNE
FT                   DRERIMRIICEQQANFVDVMTSNNNNLQISFVHSRYRNEDVAICVLVDVSSRVKMEESL
FT                   QEMAAAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLLQTKELPHGVERLVTAMNNSS
FT                   GLLLKIISDILDFSKIESEQLKIEPSEFSTVEVITHITANYLPLVVKKRFGLYCFIEAD
FT                   VPRLMLGDAVRLQQVISNLLNNAIKFTDTGCIILQVRVRGYYLEFRVRDTGVGINSREI
FT                   NQLFDPFFQVGTGVQRHFQGTGLGLAICEKLVNLMDGDVEVISELGMGSIFAIRIPLYL
FT                   KGVQHHVQNTVLPKSERWQGKILWLDIRNARLESYLLDLLSHFGATIQRYSNEQTLQDQ
FT                   VLICDYLPQINAPLSTWIQLSIEHIGLPQETRPGYWLLSTSTLLEIIPLLDHILLDQQV
FT                   VEDTPLALPAPKTNLDENADLHILVVDDHPINRRLLADQLTALGYRVITANDGLDALAV
FT                   LNTNSVDIVLTDVNMPNMDGYRLTHRLRELNHNFPVIGVTANALAESKLRCIEAGMDNC
FT                   LSKPVTLDTLRQMLRYYGDKVRKTR"
FT   CDS             complement(273807..274454)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02661"
FT                   /product="DNA-binding capsular synthesis response regulator
FT                   RcsB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27915"
FT                   /db_xref="GOA:E7B0C1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C1"
FT                   /protein_id="CBY27915.1"
FT                   /translation="MNNLNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNL
FT                   SKLDANVLITDLSMPGDKYGDGITLIKYIKRHYPDLAIIVLTMNNNPAILSSVLDLDID
FT                   GIVLKQGAPADLPKALAALQKGKKFTPESVAKLLEKISANGYGDKRLSPKESEVLRLFA
FT                   EGFLVTEIARKLNRSIKTISSQKKSAMLKLGVDNDIALLNYLSSVTIGQEKE"
FT   CDS             complement(274457..277150)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02671"
FT                   /product="two-component sensor protein RcsD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27914"
FT                   /db_xref="GOA:E7B0C0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0C0"
FT                   /protein_id="CBY27914.1"
FT                   /translation="MQNNSLSTSSANITRCFWLFIVLLLITVGLYGYNYTNAYLTEKKH
FT                   ALSYIATGLQQRIDDYRYHTYQIYDFANNPNISDKNILSAQEVRLRPDIYYIEKQRRKT
FT                   DAVIFGNHEPATLAMTLQLSDYLDSHWGAQNDTYSMYYLNGQDNSLTLITTQALKEVTS
FT                   RFKESYLTAAAESRRAEMLQQANTLDERESFSPLRKLRFQNAYYFTIRTTFNHPGHLAT
FT                   VIAFDLPINDLIPPNMARSNFLLQPDKTPINEGIAPEDTAAASVTLNGYWVEISAPLAN
FT                   ASLKIVYRVPVTVLAIDLLRNNFWLILSNILLLALAVLGIYFIRRQFVRPSTDMLDQLE
FT                   AQKSLSQEIITSLPQGLLVYNFNSNAVVASNQIADNLMPHLNLQKIAHMAEQHHGVIQG
FT                   TVNNEVYEIRMFRSKFSPETYLFLLHDQDKEVLVNKRLQQARREYDKSLQARKLMLHNL
FT                   GIELNQPINNLNQTAKELQNTTDPAVQHELVRKLAEQSESIIELIDNITLLTRLETQDW
FT                   QPEQHSFSLSALIDGLLLDVLPAINQKGLTLFNHYLVGLDQNYIGDEKVLRKILSLLLH
FT                   YSVITTAYGKITLNVDHEPGHPEQLIIQITDTGVGISDEEISNLNYPFLSQTLADRYNH
FT                   SSGLTFFLCNQLCKKLNGQLEIRSKVDIGTRYTIRVTIAIQNEQEEEQEKLLDGVTVLL
FT                   DITSEEVRSIITTLLNSFGANCIIVDDRLPGRDYDVTVTDNPQHYDNFTLLLASDEVGM
FT                   QQLQDNYIRVNYNLGSVVIDAILLLIEQQISSDEHIEKPESIAADDINAYEQQLKSSDY
FT                   YSLFVETVPVDLKKLYTELQQRDFISLSQTAHRLKGVFAMLNLLIGKQLCETLEQHIAD
FT                   GDRLKIENSISQIDSFVTRLLQQGNP"
FT   CDS             complement(277173..278237)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02681"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27913"
FT                   /db_xref="GOA:E7B0B9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B9"
FT                   /protein_id="CBY27913.1"
FT                   /translation="MAAWAPLVPFAKERIGLNDASLGLLLLCIGVGSMLAMPLTGVLTA
FT                   KWGCRAVILLAGAVLCLNLPLLVLMNTPVTMALALLVFGAAMGIIDVAMNIQAVIVEKA
FT                   SGRAMMSGFHGLFSVGGIAGAGGVSALLWLGLSPLAAIIATVALMIILLLTANKNLLQG
FT                   SGEPHDGPLFVLPRGWVMFIGFLCFVMFLAEGSMLDWSAVFLTTLRGMAPSQAGMGYAV
FT                   FAIAMTLGRLNGDRIVNGLGRYKVLLGGSLCAAVGIIIAISIDSPIAALIGFMLVGLGA
FT                   SNVVPILFTAAGNQTVMPANLAVASITTIGYAGILAGPAAIGFVAQLSNLSVAFGCVAV
FT                   LLLTVTASAKAVTR"
FT   CDS             279137..279250
FT                   /transl_table=11
FT                   /locus_tag="Y11_02691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27912"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B8"
FT                   /protein_id="CBY27912.1"
FT                   /translation="MVLLNRIIVMDNGRVVVDGPHDHILNSMANKSQQSAA"
FT   CDS             279311..279583
FT                   /transl_table=11
FT                   /locus_tag="Y11_02701"
FT                   /product="hlyd family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27911"
FT                   /db_xref="GOA:E7B0B7"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B7"
FT                   /protein_id="CBY27911.1"
FT                   /translation="MSAIVWLMLVGMIVMFIWAYFAILDEVTVGIGKVTPSSRTQLIES
FT                   LDGGIINELLVHEGAIINKGQILARLDPTHFQSNYGEAAARVRTL"
FT   CDS             279595..279744
FT                   /transl_table=11
FT                   /locus_tag="Y11_02711"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27910"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B6"
FT                   /protein_id="CBY27910.1"
FT                   /translation="MVARETQFYLSRRQNLNETVSNLQQSLKLVQQELRMTEPLAACYS
FT                   TVAN"
FT   CDS             279744..280109
FT                   /transl_table=11
FT                   /locus_tag="Y11_02721"
FT                   /product="hlyd family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27909"
FT                   /db_xref="GOA:E7B0B5"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B5"
FT                   /protein_id="CBY27909.1"
FT                   /translation="MEIVPIEEQLLIETRINPRDIAYIRPGLPATAKITAYDSSIYGNP
FT                   TGVVETVSPDTLQNEVKRDQLYYRIYVRTNLTNKAGKLFPILPGMVASVEIKTGQKTVL
FT                   DYLIKPLNKVKESLRER"
FT   CDS             280276..280389
FT                   /transl_table=11
FT                   /locus_tag="Y11_02731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27908"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B4"
FT                   /protein_id="CBY27908.1"
FT                   /translation="MKLYLLAIISFCKYTRHYKYTELSIFQAIKKPVKDRP"
FT   CDS             280776..281879
FT                   /transl_table=11
FT                   /locus_tag="Y11_02741"
FT                   /product="outer membrane protein C precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27907"
FT                   /db_xref="GOA:E7B0B3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B3"
FT                   /protein_id="CBY27907.1"
FT                   /translation="MKLRVLSLLVPALLVAGSAGAAEIYNKDGNKLDLYGKVDGLHYFS
FT                   DDNSKDGDQSYMRFGLKGETQISDQLTGYGQWEYQANLNKAEDEDQGNFTRIGFAGLKF
FT                   ADYGSFDYGRNYGVLYDVTSWTDVLPEFGGDTYGADNFLSQRGNGMATYRNTNFFGLVD
FT                   GLNFALQYQGKNGDGTETNNGRSVQGQNGDGYGMSVSYDLGWGVSASAAMASSKRTDEQ
FT                   NDLAFGHGDRADAYSGGLKYDANNVYLAATYAQTYNLTRFGNFKNNTDSGFANKAQNIE
FT                   LVAQYQFDFGLRPSIAYLQSKGKDLGNGYSDQDLVKYVDVGATYYFNKNMSTYVDYKIN
FT                   LLDENEFTKNAGINTDDIVAVGLVYQF"
FT   CDS             complement(281947..282099)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27906"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B2"
FT                   /protein_id="CBY27906.1"
FT                   /translation="MSSVSFKKNWNLVRLVKLHAKTGQKKSKWLKIRPRYAMMPKTKIP
FT                   NKIDR"
FT   tRNA            282133..282220
FT                   /locus_tag="Y11_t27310"
FT                   /product="tRNA-Ser-TGA"
FT   tRNA            282227..282302
FT                   /locus_tag="Y11_t27300"
FT                   /product="tRNA-Thr-TGT"
FT   CDS             complement(282394..283524)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02761"
FT                   /product="penicillin-binding protein AmpH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27905"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B1"
FT                   /protein_id="CBY27905.1"
FT                   /translation="MLKHFSPPLLAAALFAMPLHSYANTELLTSQVVDQYAEHIFYNSG
FT                   AMGMALVVIDNNQVVNRSFGETKPGNNLRPRPDSLIRIASITKLMTSEVMVKLAEDGTV
FT                   KLTDPLQKWAPKGARVPAYNAKQPITLLNLSSHTSGLPREQPGGPQKRPVFTWPTKDNR
FT                   LQWLKLAKVTVPPGVKAAYSNLAYDLLADALSRASGKPYTSLLRDKITAPLGMRNTTLT
FT                   PTAEQCSRLMVGVGSSRCENTIAAAGSGGVYSTPEDMQRWMQQFLASNNSARKSTAKRE
FT                   QALYFQRRDLVSLKGMDVAGQADALGLGWVYMAPNAELPGIMQKTGGGGGFITYMAMIP
FT                   EKNIGVFVVVTRTQLTKFTNMSDGVNRLVAQLAKNS"
FT   CDS             complement(283716..285242)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02771"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27904"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0B0"
FT                   /protein_id="CBY27904.1"
FT                   /translation="MSKTITTRHTLAYGSANLLGSGALAISGAWLMYFYTTFCGLSVVE
FT                   AATIFSIASILDAISNPVMGYITDNFYNTRLGRLFGRRRFFILLGIPLVLVYPMLWMSG
FT                   FGFWYYLLTYALFELIYTSIMVPYETLATEMTTDFAKRSKLTGSKAIFGKVANFLAAFI
FT                   PGQFIAIYGKDSATPFLYTGIAYGLIMCCAMIWLYSSSWERPASEVVRETTSSLGQALK
FT                   KLCIDMASTFHLRIFRKHLGMYLFGFGAEWLFASAFTYFIIFGLGQDAALVSQLNSFSS
FT                   IMQLISTAIFIGICVKMGFARPFRIALQVVIVSVIAYAALYFTGWSQTTTVIVLFGITA
FT                   VFGLSTGGIYYIPWTVYTFLADVDEVLTGRRREGIYAGAMTFAGKMVRSIIVFAMGWTL
FT                   SRFGFVSGQSSQPEVAVQAIVGVFAIGVVSLALVAIYYTTQMKLDRKNHKILLEEIDRI
FT                   KSGGAMADIPAHARAVAEELTGWKYEQCWGNNPLGMKESSNVIPKPVTES"
FT   CDS             285656..286645
FT                   /transl_table=11
FT                   /locus_tag="Y11_02781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27903"
FT                   /db_xref="GOA:E7B0A9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A9"
FT                   /protein_id="CBY27903.1"
FT                   /translation="MAKKNPYYDASKPHHTEFGFQNLEPVVHHPQDLKRWREERKRLSL
FT                   PKPPQQGYEQFVADWWQLADFSGQQDALWWLGHASLLLRVSGKTVLFDPVLSNRASPLN
FT                   FYGPARRTPAPASVKALPHIDVVVISHNHYDHLDVTTITQLLRRFPDVTFLAPLGLKNW
FT                   FLHHGARHVHELDWWDTHLVAEFEFHCVPARHWSMRTPWDRNQSLWSGWVVKRDVINFY
FT                   FTGDTGYCPQLLSIGERLGPFNYAALPIGAYAPRWFMNAQHMDPQQSVQLFKQLQQPTT
FT                   VPIHWGVFELADESLDEPPQQLKHALTEAGVAGDNFAPLKIGARILLE"
FT   CDS             286605..286718
FT                   /transl_table=11
FT                   /locus_tag="Y11_02791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27902"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A8"
FT                   /protein_id="CBY27902.1"
FT                   /translation="MHRLKLVLGYYLNSVVFQQVKGHPLKPTKAHSIELTR"
FT   CDS             complement(286715..288502)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02801"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27901"
FT                   /db_xref="GOA:E7B0A7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A7"
FT                   /protein_id="CBY27901.1"
FT                   /translation="MLDSIRSRILAACVVIVAGSLAINTYFNYSVANKYNSSAIDNTLK
FT                   AVTASHGVGIADWVAMKTQMIVSLKESALAADPIAALRQVAAAGNFINVYIGYANKTAV
FT                   FSNPDGIPAGYDPTGRPWYLQAVKAGSPVVTPPYIDAGTNQLVVTFALPIIQDGSVKGV
FT                   LAADVTMDSVIANVKSIHPTDDSIGMLIDADGTIIAHPDSQLTLKPLSEIAPTLDLKTL
FT                   LTAISPTAAEIGGSTKLLLAQAVPGTQWFTVVALDKAHATAGMRSLLTTSLVTLIVIIL
FT                   IAVVIISLITQRALTPLTHVHKAMDAISSGTEDLTQRLPVEGHDEVAKIALSFNNFADK
FT                   LSDVMAQIRNTSESVSIAANEIAAGNQDLSGRTESAAASLQQTSAALEQISATVAQSAS
FT                   AARQANTAVLSAANDASRGGEVIAKVITTMESIEAASGKIGDITSVIDGIAFQTNILAL
FT                   NAAVEAARAGEQGRGFAVVAGEVRTLAQRSAQAAKEIKTLIDSTVSSVASGSGQVRQAN
FT                   NTMTEIVSSVSDVTTIMSEITNAADEQMRGIHEINSAVTQLDTMVQQNAALVQESTAAS
FT                   AALQAQAADLTSAVNQFRI"
FT   CDS             complement(288828..289763)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02811"
FT                   /product="protease VII (Omptin) precursor"
FT                   /EC_number="3.4.23.49"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27900"
FT                   /db_xref="GOA:E7B0A6"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="InterPro:IPR023619"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A6"
FT                   /protein_id="CBY27900.1"
FT                   /translation="MEANIAVKQILSASILLALSHSAVASHHTNITDSLTVSTALGLLN
FT                   TEANEYVYDSNNRKVSQLDWKAENTPIIKMDVSWDLLSRLTLTARGWSTLSSGTGTMDD
FT                   YDWRKSDQTKWTDWSHHDKTNLNYANEIDLNAKFWFLKQKNYRIAMMSGYQRNNSSWTA
FT                   YGGNYNYDNGKDIFSTSDTVTVIGYKQKFDMSYLGLAGSYHYQKFEFNTLLKYSRWVNA
FT                   NGHDEHYSRKLSFKDSNKNSRYYAIVVDAGYYITPSTKLFVEAAWNQYTEGKGATQILD
FT                   RTAGTSQNHADSSGIAQKNYTIGFGLLYKF"
FT   CDS             complement(289928..290170)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02821"
FT                   /product="putative stress response protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27899"
FT                   /db_xref="InterPro:IPR010391"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A5"
FT                   /protein_id="CBY27899.1"
FT                   /translation="MRVELIYDKRNVAGLTNANEMIKAELTKRVHQVFPGAEVKVKPMQ
FT                   ANGINTDATKQEKSVLNRLVEEMFEQADEWLVHEF"
FT   CDS             complement(290517..291140)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02831"
FT                   /product="putative cI prophage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27898"
FT                   /db_xref="GOA:E7B0A4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A4"
FT                   /protein_id="CBY27898.1"
FT                   /translation="MKKKPLTPEQLDDAKRLKELFNAKKKALGISQESVAHELGVGQSA
FT                   VNQFLNGINPLNVTNAAAFAKVLNEPISSFSPSLATELAKMAESLSISSLNRLNDKPPG
FT                   TVANSYPLISWISAGNWYETIEPYQLSDIEIWPESTKNAHDSAFWLRVKGDSMTSPSGI
FT                   SFPEGMIILVDPEKEPIPGNFVVAKLTDDNEATFKKLIVDAGVK"
FT   CDS             291437..291796
FT                   /transl_table=11
FT                   /locus_tag="Y11_02841"
FT                   /product="putative phage antitermination protein Q"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27897"
FT                   /db_xref="GOA:E7B0A3"
FT                   /db_xref="InterPro:IPR010534"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A3"
FT                   /protein_id="CBY27897.1"
FT                   /translation="MSSINGNAAGSHSQKSQSLRDIQLVLARWGVWARYSSGLDYSSIA
FT                   AGFKGLLVDTSKSKVSCCDDDGLVVDGGVARQLESERRLRYEAEDRLKRFTLATASDNC
FT                   AASRMPESGIDILRE"
FT   CDS             291849..292016
FT                   /transl_table=11
FT                   /locus_tag="Y11_02851"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27896"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A2"
FT                   /protein_id="CBY27896.1"
FT                   /translation="MTQCEIPKFTGATWSDSALYAMTLKQALRICKGRLDEVIQWRNSQ
FT                   INSRYRKEVP"
FT   CDS             292103..292474
FT                   /transl_table=11
FT                   /locus_tag="Y11_02861"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27895"
FT                   /db_xref="GOA:E7B0A1"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A1"
FT                   /protein_id="CBY27895.1"
FT                   /translation="MNAAQIRQLAATALMDKTDAEVRVYSTDVWPVTQYPAILLQTPME
FT                   VKESIGRNAPQFKTMTTLRISGHIQLSEAENRVTEAASALERLCGKIQRVVINSDELTC
FT                   QIQQFAKVRTTMDMSFQCC"
FT   CDS             292565..293305
FT                   /transl_table=11
FT                   /locus_tag="Y11_02871"
FT                   /product="phosphosugar-binding transcriptional
FT                   regulator,RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27894"
FT                   /db_xref="GOA:E7B0A0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B0A0"
FT                   /protein_id="CBY27894.1"
FT                   /translation="MFTYKEISSLNELELIVYNYIIKNTDKVMYMTIRELADAAGVSTT
FT                   TVLRFCKKMNCDGYSEFRVRFKLYLEHDEKPPVSFGISEIISYFKSINNSEFDELLDSA
FT                   AAQIAATRRIIFVGIGTSGALGKYSARFFSNVGKYSTYIDDPYYPINSDMYQDAIAIIL
FT                   SVSGETEEIIRIANQFSLQHCKIISLTNSDNSTLAKMADLNISYHMPPIVLEGQYNITT
FT                   QIPVLYIIETIGKKLPQLVNKNTK"
FT   CDS             293323..293457
FT                   /transl_table=11
FT                   /locus_tag="Y11_02881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27893"
FT                   /db_xref="UniProtKB/TrEMBL:E7B099"
FT                   /protein_id="CBY27893.1"
FT                   /translation="MLHIPINGFCYIVTSFFFLLNSSLNRKNINNNPITLCLSYTQHS"
FT   CDS             293471..294997
FT                   /transl_table=11
FT                   /locus_tag="Y11_02891"
FT                   /product="PTS system, beta-glucoside-specific IIB
FT                   component; PTS system, beta-glucoside-specific IIC
FT                   component; PTS system,beta-glucoside-specific IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27892"
FT                   /db_xref="GOA:E7B098"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:E7B098"
FT                   /protein_id="CBY27892.1"
FT                   /translation="MAIDYALTAQEIIKYIGGDNNVITVTHCATRLRFILKANKAVDKE
FT                   KLNRVKGVITVIEAGGQMQVVIGNHVGDAYKHVTSLINIDESEPVAAPKVGIVSRLMDI
FT                   ISSIFAPFLYPLAACGILQGIISFLAAVGWMDAASGTYRILNFVSWTGFTFLPVMVAFT
FT                   AAKKFNVNPFTAVITACALISPDYMNMLTANKIVTVNSADPAVQQLMHEALNNPQVAHI
FT                   LNTIAGIPLSSPTLDFFGIPVQYLSYTASVIPIILMVWAMSHVQRFFEKVLPMVVRNLF
FT                   TPMFCIAIMVPLTLLVFGPVGNLIGGAIGGAYNTLYNLSPAIAGFMVGAFWQPLVTLGV
FT                   HWGITPVTVGNYATLGYDTFTGLQASAVFAMAGTMFGVYLKTRNREMKGISLSAGITAL
FT                   FGITEPAIYGVALRLKKPFLCSCAAGGIGGAIAGSFNAVSWSYCLPGIAVLPVFFKEGH
FT                   MAQFLGFLLSITVAFILGAVFTWLVGFTDEPENVEQPDSAKASEAPIAQA"
FT   CDS             295101..296537
FT                   /transl_table=11
FT                   /locus_tag="Y11_02901"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27891"
FT                   /db_xref="GOA:E7B097"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:E7B097"
FT                   /protein_id="CBY27891.1"
FT                   /translation="MSHKQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGAHGV
FT                   DRVMTDGVQEGYRYPNHEAVDFYGHYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELQP
FT                   NEAGLQFYDDMFDELLKYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSVVVM
FT                   ERYKSKVKYWMTFNEINNQRNWKYPLFGYCCSGVVFTEQENPEETMYQVLHHQFVASAK
FT                   VVKLGHAINPEFKIGCMVAMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYI
FT                   LNEWERRGFTINMEEGDLDTLREGCADYMGLSYYMSNAVSAVNPGSGNSLSGFEGSVPN
FT                   PHVKASDWGWQIDPVGLRYSLSVLYERYQKPLFIVENGFGAIDKVADDGMVHDDYRIAY
FT                   LKAHIEQMKKAVFEDGVDLMGYTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMAR
FT                   SRKQSFDWYKKVIASNGEEL"
FT   CDS             296813..297307
FT                   /transl_table=11
FT                   /locus_tag="Y11_02911"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27890"
FT                   /db_xref="GOA:E7B096"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="UniProtKB/TrEMBL:E7B096"
FT                   /protein_id="CBY27890.1"
FT                   /translation="MKGKLLFAAMLVASFSASAAEHAHWGYEGQEDPAHWGKLSPDFSL
FT                   CETGKSQSPVNIHGALKTHHGQLELNFQQGKQQIVNNGHTIQINASTGNTLKLDGDTFT
FT                   LQQFHFHAPSENEIDGKQFPLEAHFVYKDNKGELVVLALLFQLGKANTQLARAFIILCH
FT                   V"
FT   CDS             complement(297315..298517)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02921"
FT                   /product="ISsod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27889"
FT                   /db_xref="GOA:E7B095"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E7B095"
FT                   /protein_id="CBY27889.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKQLTEAALAAELDS
FT                   HLAQDLEANRKNGSGKKTIKAPTGRFELTTPRDRNGTFEPQLVKKHQTTLSDEIERKII
FT                   RMFALGMSYKDISQEIEDLYAFSVSSATISAVTDKVIPELKQWQQRPLEAVYPFVWLDA
FT                   IHYKIRENGRYQSKAVYTVLALNLEGKKEILGLYLSENEGANFWLSVLTDLQNRGVNDI
FT                   LIACVDGLTGFPEAINSIYPDTEVQLCVIHQIRNSIKYVASKHHKAFMADLKPVYRAVS
FT                   KEAAETALDELEEKWGQQYPVVLQSWRKKWENLSHYFRYPATIRKVIYTTNAIESVHRQ
FT                   FRKLTKTKGAFPNENSLLKLLYLGLMNAQEKWTMPIQSWNLTLSQLAIYFEGRLDKVIT
FT                   L"
FT   CDS             complement(298904..299359)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27888"
FT                   /db_xref="UniProtKB/TrEMBL:E7B094"
FT                   /protein_id="CBY27888.1"
FT                   /translation="MDTVEELNGTYFYKGMINLSAPELLFWVMIDAVEEQLGVQDMVAV
FT                   ASLILGGNYISVPGKPLTATKGTSPASLFFRKNLRYIFKSRVLPTLTQKSFSLRGIKIF
FT                   WVNNLGAFVGRAVPVVGWVILANDVAQISIKTATRYNNIARMDDQLW"
FT   CDS             complement(299601..299717)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27887"
FT                   /db_xref="UniProtKB/TrEMBL:E7B093"
FT                   /protein_id="CBY27887.1"
FT                   /translation="MGFGWCGYGVAMVWLWCETQEKNSGNIWLLRLNTSIQC"
FT   tRNA            complement(299762..299838)
FT                   /locus_tag="Y11_t27100"
FT                   /product="tRNA-Pro-GGG"
FT   CDS             complement(299936..301729)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02951"
FT                   /product="hydrolase of alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27886"
FT                   /db_xref="GOA:E7B092"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:E7B092"
FT                   /protein_id="CBY27886.1"
FT                   /translation="MVTNRQRYREKVSQMISWGHWFALFNILFSLVLGSRYLFVSDWPS
FT                   SLIGRVYALVSWLGHFSFIVFAAYLLVIFPLTFVVMSQRLLRFISAAFATAGLTLLLVD
FT                   TEVFTRFHLHLNPVVWELVVNPDQTELARDWQLMFIAVPVIFLVEMLFGTWAWQKLRSL
FT                   NRQRFVKPLVAVFILAFFASHLIYIWADANFYRPISMQRANLPLSYPMTARKFLEKHGL
FT                   LDQEEYQRRLIEQGNPDALTVEYPLSPIVFSDNGSGYNLLLIVVDGIRANSLQKDMPAL
FT                   SEFGHANIQFDRHYSSGNRQDTGLFGLFYGISPTYLDGILSARKPSAFITSLSAQGYQF
FT                   GLFSSDGFASPLYRQALLSDFTLPAPAEQTDSETTAQWQQWLSTLNSNAPWFSYINLNG
FT                   AVEAQDPVIGHKVALPTDFIHNYQTAAKDVDQQIATILDTLKQRGQLDKTVVIITAAHG
FT                   VEFNDTGNDNWGAGSSFNRQQLQVPLIVHWPGTPAQKVNKLTNHEDIMATLMQRLLHVK
FT                   TASEDYSQGEDLFAAQRNNNWVATGDNGTLVITTPTQTIVLDNNGEYRTYDMQGNEIKD
FT                   EKPQLPLLLQVLTDIKRFIAN"
FT   CDS             complement(301757..301984)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02961"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27885"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/TrEMBL:E7B091"
FT                   /protein_id="CBY27885.1"
FT                   /translation="MPQSSRYSDEHVEQLLSELVSVLEKHRTPTDLSLMVLGNMVTNLI
FT                   NTSIAPAQRKVLARSFAEALQASVREDKAH"
FT   CDS             302162..303163
FT                   /transl_table=11
FT                   /locus_tag="Y11_02971"
FT                   /product="nucleoid-associated protein NdpA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27884"
FT                   /db_xref="GOA:E7B090"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:E7B090"
FT                   /protein_id="CBY27884.1"
FT                   /translation="MSLDIDQIALHQLVKRDEQTLDVVLRDSLLPANAVVEEMMAELHR
FT                   VYSAKSKAYGLFNEQSELADALKRSRKGDEDFLSFSRAATGRLRDELAKYPFAEGGVVL
FT                   FCQYRYLAVEYLLISVLSSCNSMRVNEQLDLSTTHYLDINRADIVARIDLTEWENNPES
FT                   TRYLTFLKGRVGRKVSDFFMDFLAASEGLDTKAQNRGLLQAVDDYCADAELGKNERQAY
FT                   RQQVYSYCNEQLQAGEEIALQELAQELPKLGEKDFQQFSVEQGYALEESFPADRGTLRQ
FT                   LTKFAGSGGGLSINFDALLLGERIFWDAATDTLTIKGTPPNLRDQLQRNSGK"
FT   CDS             complement(303245..303532)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02981"
FT                   /product="LSU ribosomal protein L25p"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27883"
FT                   /db_xref="GOA:E7B089"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="UniProtKB/TrEMBL:E7B089"
FT                   /protein_id="CBY27883.1"
FT                   /translation="MITIKAEVRNDQGKGASRRLRAANKFPAIIYGGSEAAIAIELDHD
FT                   TTKNLELKPGFYDNTGLTLVINGKETKVKVQAVQRHAFKPKLTHIDFVRI"
FT   CDS             complement(303694..305451)
FT                   /transl_table=11
FT                   /locus_tag="Y11_02991"
FT                   /product="DNA or RNA helicase of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_02991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27882"
FT                   /db_xref="GOA:E7B088"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B088"
FT                   /protein_id="CBY27882.1"
FT                   /translation="MAFTLRPYQQEAVDATLAHFRRHAEPALIVLPTGAGKSLVIAELA
FT                   KLARGRVLVLAHVKELVAQNHAKYCAYGLEADIFAAGLQQRQSEGKVVFGSVQSVARNL
FT                   SLFDSAFSLLIIDECHRISDEDDSQYQQIIQHLRTTNPRLRLLGLTATPYRLGKGWIYQ
FT                   FHYHGITRGDEKSLFRDCIYELPLRYMIKHGFLVPPERLDMPVVQYDFSRLTSNSDGMF
FT                   REVDLDRELKQQQRITPHIVSQIMEYAAHRRGVMIFAATVEHAKEVYGLLPKGEAALVS
FT                   AGTPPAERDALITAFKQQQLRYLVNVAVLTTGFDAPYVDLIAILRPTESVSLYQQIVGR
FT                   GLRLSPGKEDCLILDYAGNPHNLFTPEVGTSKPHGDSQPVQVFCPDCGFANIFWGKCTE
FT                   SGEIIEHYGRRCQGWFEDDQGAQAQCDYRFRFKSCPHCSAENDIAARRCHQCQEVLVDP
FT                   DDMLKAALKLKDALVLRCGGMSLEAGQDAKGEWLKITYYDEEGTNTSERFRLTTAAQRM
FT                   AFEQIFLRPHQRAPGIALKWQTAADIIAQQALLRYPDFVVARRRGQWWQIREKVFDYQG
FT                   RFRRADSLA"
FT   CDS             305913..306620
FT                   /transl_table=11
FT                   /locus_tag="Y11_03001"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27881"
FT                   /db_xref="GOA:E7B087"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E7B087"
FT                   /protein_id="CBY27881.1"
FT                   /translation="MRLDKFLSQQLGVSRALVARELRAKRVTIDGEVVKSGAIKLTPEQ
FT                   DVRFDGNPLQQTVGPRYFMLNKPQGYVCSTEDPDHPTVLYFLDEPVAYKLHAAGRLDID
FT                   TTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLEQPIADDTAQQFTDGVQLHNEKSLTKP
FT                   AQLEVIEPQLVRLTISEGRYHQVKRMFAAAGNRVLELHRERIGDIKLDDDLAPGEYRPL
FT                   TPEEIASVGAPHL"
FT   CDS             306719..307942
FT                   /transl_table=11
FT                   /locus_tag="Y11_03011"
FT                   /product="mfs family multidrug transport
FT                   protein,bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27880"
FT                   /db_xref="GOA:E7B086"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B086"
FT                   /protein_id="CBY27880.1"
FT                   /translation="MHASNPNEAKNRTSHVGLIFILGLLSMLMPLAIDMYLPSMPIIAQ
FT                   EFGVESGAVQMTLSAYVLGFAIGQMFYGPMADSIGRKPVIFWGTLIFALAGMACAMAQS
FT                   VEQLINLRFLHGLSAAAASVVINALMRDMFTKDDFSRMMSFVVLVMTIAPLLAPIIGGA
FT                   LLVWFSWHAIFWSMAGTALVGAILVALFIKESLPKEKRQRFRLRTTIGNFVTLFRHKRV
FT                   LCYMLASGFSFAGMFSFLSAGPFVYIDLNGVSPQNFGYYFALNIVFLFLMTLINSRNVR
FT                   RFGALKMFRFGMLVQFVMGIWLLVVCATGLGFWALVLGVAAYVGCIAMITSNAMAVILD
FT                   DFPHMAGTASSLAGTLRFGIGAVVGTLLSMAPSRSAWPMVSSMAFCIIVAMLLYLYASR
FT                   PQNKGAVK"
FT   CDS             308795..309142
FT                   /transl_table=11
FT                   /locus_tag="Y11_03021"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27879"
FT                   /db_xref="InterPro:IPR020489"
FT                   /db_xref="UniProtKB/TrEMBL:E7B085"
FT                   /protein_id="CBY27879.1"
FT                   /translation="MNNIQLSVVHRLPQSYRWLSGFIGVKVEPMPLAAIDDSNNDLMGL
FT                   KLLSHDGKHAQIIMQRLHLSLQEIQVDSAIVEWEGELCLFVHRQDESATMCRLKDVGVA
FT                   IAETMTALYPF"
FT   CDS             complement(309214..310806)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03031"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27878"
FT                   /db_xref="GOA:E7B084"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B084"
FT                   /protein_id="CBY27878.1"
FT                   /translation="MATSPLLDIQNLSIAFRQAGAEHQVVSELSLQIDVGETLALVGES
FT                   GSGKSVTALSILRLLPSPPVVYPSGDILFAGKSLLHADEPTLRGIRGDQISMIFQEPMV
FT                   SLNPLHTIEKQLSEVLSLHRGMRQEAARTEIIQCLDRVGIRNAKGRLADFPHQLSGGER
FT                   QRVMIAMAVLTKPKLLIADEPTTALDVSVQAQILSLLKELKQEMGMSLLFITHNLNIVR
FT                   RLADNVAVMREGRVVERNTRQALFNSPQHAYTRQLLDAEPQGEPLPLQTGLQPLLEVKG
FT                   LQVAFPIKRGLLRRTVSHHYALKDLSFALRPGESLGLVGESGSGKSTTGLALLRLLPSQ
FT                   GEIWFDGQPLHNFSPKQMLPYRSRIQVVFQDPYSALNPRLNIQQIIAEGLEVHQKLSAA
FT                   HRELRVIKAMEEVGLDPVSRYRYPTEFSGGQRQRIAIARALILQPQLLILDEPTSSLDK
FT                   SVQAQILALLKSLQQRYQLSYLFISHDLQVVRSLCHQVIVLKQGEVVEQGDCQSIFAAP
FT                   KQQYTQQLLQFAD"
FT   CDS             complement(310808..311836)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03041"
FT                   /product="oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27877"
FT                   /db_xref="GOA:E7B083"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:E7B083"
FT                   /protein_id="CBY27877.1"
FT                   /translation="MIKRLSAINQARWARFRQNRRGYWSLWIFLTLFIISLFAELIAND
FT                   KPLLVSYQGKFYMPFMVNYTESTFGGILTTAADYQDPYVIGRIKDNGWAIWAPIRFSNN
FT                   TINFATDVPFPSPPSHTNWLGTDSTGGDVLAKIIYGFRISLLFGLTLTLLSSVIGIFAG
FT                   AVQGYYGGKIDLLGQRFIEVWSGMPTLFLIILLSSIVQPNFWWLLAITVIFGWMGLVGV
FT                   VRAEFLRTRNYDYIRAARAMGVRDRVIMSRHMLPNAMVATLTFLPFILCGSITTLTSLD
FT                   FLGFGLPMGSPSLGGLLLEGKNNLQAPWLGITAFLVLAVLLSLLIFIGEAVRDAFDPSK
FT                   VY"
FT   CDS             complement(311833..312933)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03051"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27876"
FT                   /db_xref="GOA:E7B082"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7B082"
FT                   /protein_id="CBY27876.1"
FT                   /translation="MGAYLLRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIANIELG
FT                   HSSGYSTGGGDSGLGGAKVGLNAAQVGDSNYRGSRGLDPEVIAEIKQRFGFDKPLHQRY
FT                   FEMLWSYARFDFGDSLFRGESVMSLIKHSLPVSISLGLWSTLIIYLVSIPLGIKKAVRS
FT                   GSAFDTWSSTLIIIGYAIPSFLFAILLIVLFSGGSYFDLFPLRGLVSSNWDTLPWYGKI
FT                   TDYLWHITLPVLATVIGGFATLTMLTKNSFLDEIRKQYVVTARAKGLPEEKILYRHVFR
FT                   NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATLQRDYPVMFGTLYIFTL
FT                   IGLLLNILSDITYTLVDPRIDFEGRQ"
FT   CDS             complement(312943..314751)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03061"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27875"
FT                   /db_xref="GOA:E7B081"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:E7B081"
FT                   /protein_id="CBY27875.1"
FT                   /translation="MLLRLFAALALSALSFGLQAETIKEGSSFAILGEPKYSSDFSHFD
FT                   YVNPAAPKGGDITLSAIGTFDNFNRYALRGNPAVRTERLYDSLFSTSDDEIGSYYPLIA
FT                   ESARFAPDFHWIEVDINPRARFHDGKPITAQDVAFTFNKFMTEGVPQFRIVYKGVQVKA
FT                   ISRLTVRFEFPEPNKDKMLGLFGLPVMPEHFWKDHKLSDPLSQPPVSSGPYRIGKYKMG
FT                   QFITYERVRDYWAANLPVNRGQYNFDTIRYDYYLDDKVALEAFKAGAFDFREETSPKSW
FT                   ATQYVGGNFAKNTIVKQDILDNSAQNTRWLAFNVQRPIFSDRRVREALTLAFDFDWMNK
FT                   AFYFDSYQRTNSFFQNTEYAAKGYPDSAELAWLAPLKGKIPPEVFTQIYQPPQTDGSGN
FT                   ARDNLLKARELLSEAGWEIKNQQLVNRKTGKPFVFELLLLSGSNFQYVQPFKHNLQRLG
FT                   ITMNIREVDSSQFVNRLRSRDYDMIPTVYSAFPYPSPNLQIFWSSAYIDSSYNASGIKD
FT                   PAIDQLIEQIVKHQEQPEALLSLGRALDRVLTWNYLMIPMWYSNHARFAYWDKFSMPAD
FT                   RPTYSLGFDSWWFDVNKAARLPTERH"
FT   CDS             complement(314850..316412)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03071"
FT                   /product="rtn protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27874"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="UniProtKB/TrEMBL:E7B080"
FT                   /protein_id="CBY27874.1"
FT                   /translation="MGSNSAFSRNILSRRHLVKKSVILALCFFILFAVITLSLLYRSSE
FT                   RKLTLQSDHIIAYSSQFLSELTTSMSQLIPLSAKNCEQASSALHYRAAFTNGVRAFLLV
FT                   RNDIAYCSSATGEMNVPVSALYPKINVSQPLDFKIQQGTPMMPGKPAIGVWLREAGRGN
FT                   TGVLATLELTLHPYLLLNYSNNQVNGLAIIIDELAVTTFDAKVIPISQLPTRDAREIQL
FT                   PGYPIKILIYHTSLTADDIRMTLLGGLLLAGLVGILAYYILIASQSAEAEILRGIRRGE
FT                   FFVEYQPVFRSNDRSISGLEALIRWQHPIEGRISPDLFIPYAEAQHLIQPLTQHLFELI
FT                   IKDSKLMAAHVPAGVKLAFNISPVHLTDDNFRKDVTQMLQQLNTDVFSPVFEVTERGMV
FT                   EEELAIEQFAWLRSQGIQIAVDDFGTGHSALIYLERFTLDFIKIDRGFVSTIGINTVAA
FT                   PVLDAVLMLANKLNIETVAEGVETEQQLQYLAQHGVNYLQGYLLSKPLSVEDLVKFCNK
FT                   KTS"
FT   CDS             complement(316936..317520)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03081"
FT                   /product="lipoprotein spr precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27873"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:E7B079"
FT                   /protein_id="CBY27873.1"
FT                   /translation="MVKSQPIMRYILRVIPAVAAAVMLSACSSPQTSNLHNTQTEMRAV
FT                   NDKDGLLLQASQDEFEAMVRNVDVKSKILEQYAGWKGVRYRLGGSSKRGIDCSAFVQTT
FT                   FREQFGMDLPRSTSEQQDLGKKIQRTKLRPGDLVLFRAGSTGRHVGIYLGNDKFVHAST
FT                   SVGVTISSLNEDYWNKRYRDGRRVLSSGSRS"
FT   CDS             complement(317899..318600)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03091"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27872"
FT                   /db_xref="GOA:E7BAR2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAR2"
FT                   /protein_id="CBY27872.1"
FT                   /translation="MTRRNLPTILLLNLLGIALFFSWYIPANHGFWFKIDSAIFFYFNQ
FT                   HLLSSPPFLHLVAITNNRAFDVISLICMGLLYLYFYMKETTAGRRRLIVTGFVMLLTAV
FT                   ILNQLGHLLPVSHPSPTLTFENINRVSELTGIPTKDASSDSFPGDHGMMLMIFACFMLR
FT                   YFSRGAFVIALLIVVLFSMPRIMIGAHWFTDIAVGSLSIVLVGMSWILLTPLSDKLINV
FT                   INRNLPGSKNR"
FT   CDS             complement(318664..319647)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03101"
FT                   /product="putative metal chaperone, involved in Zn
FT                   homeostasis, GTPase of COG0523 family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27871"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAR1"
FT                   /protein_id="CBY27871.1"
FT                   /translation="MTKTNLITGFLGCGKTTTIRHLLSQKPEHEKWAVLVNEFGEIGID
FT                   GALLADSGAVLKEIPGGCMCCVNGLPMQVGLNMLLQQAKPDRLLIEPTGLGHPKQILSL
FT                   LTSDIYQPWISLHATLALLDARQLSEPRYTENENFRDQLAAADVLVANKQDAYSEMDYA
FT                   VLKQWHEQQPVSRPLYYAEQGKIDIALLDILHSNNDELPDGAHHHSSTRQKGLAALSLK
FT                   ANEPWRRALNQGQGYLSCGWVFNADTVFDTVPLLEWVRLSPVERIKGVMRIPEGTLVVN
FT                   RQGHDLKIETRQIPPLDSRIELISTTDHDWNSLQHELLRIRLHKGV"
FT   CDS             319974..320285
FT                   /transl_table=11
FT                   /locus_tag="Y11_03111"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27870"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAR0"
FT                   /protein_id="CBY27870.1"
FT                   /translation="MQIILAILFSWTISFAASSAQSTLSVGGTITYSGAIVESPCDTSF
FT                   SDQTITTRCYRNGETLTQRQTLSRNMSLTSRLPNQLASSNLEWLNPQRSLGILTVTYL"
FT   CDS             320512..321255
FT                   /transl_table=11
FT                   /locus_tag="Y11_03121"
FT                   /product="uxu operon transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27869"
FT                   /db_xref="GOA:E7BAQ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ9"
FT                   /protein_id="CBY27869.1"
FT                   /translation="MRLYQEVGSQLREAIISGQYNLGDRLPPERDIAENFSVSRSVVRE
FT                   ALIMLELEKLVEVRKGSGVYVVNVPDRLVNGESVVSADSGYGPFELLQARQLLESEVAA
FT                   FAAMQATKADIIKMRQAIEQEKTALDAGAVDESADELFHCLLAQSTQNSVLANMVAEAW
FT                   QARKTSAMWQGAHSHTLDFSYRWQWMEDHQKILQAVLRRDSKAAKQAMWQHLENVKLKL
FT                   LEISDANHPDFDGYLFESAPYQLEE"
FT   CDS             complement(321355..322827)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03131"
FT                   /product="D-mannonate oxidoreductase"
FT                   /EC_number="1.1.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27868"
FT                   /db_xref="GOA:E7BAQ8"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ8"
FT                   /protein_id="CBY27868.1"
FT                   /translation="MNTIANSRLPDTVQQPAYDRTALKNRIVHIGFGAFHRAHQALLTD
FT                   RVLNKQGGDWGICEISLFGADVLIQNLRQQDHLFSVLEKGAQSNQAIVVGSVCESVHAR
FT                   LDGVMQVLEKLAEPQVAIVSLTITEKGYCIEPGTGQLDLQNEFVRADLAIPDAPTSAPG
FT                   VLIEALRLRRLRGLPPFTVLSCDNIPENGHVVKNAVLGLATARDPELASWIEQNVTFPN
FT                   TMVDRIVPAATPETLQEIADTLGVADACGIACEPFIQWVVEDKFVAGRPDWRAAGVQLV
FT                   DDVLPFEEMKLRMLNGSHSYLSYLGYLAGYQHINDCMADENYRLTARRLMMIEQAPTLR
FT                   VTGIDLNAYADQLIERYSNPSLKHRTWQIAMDGSQKLPQRMLDSVRWHLQNGGPYRCLA
FT                   LGIAGWMRYVSGVGDNGQPIDIRDPMVDSFKTCVENSEDGVARVQSLLSLKSLFGESLP
FT                   QQSEFVQAVTEAYLSLQQIGAKETVKRLAQQG"
FT   CDS             complement(322902..323084)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27867"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ7"
FT                   /protein_id="CBY27867.1"
FT                   /translation="MSKSKTSLVDPLHEYNQYWTYQFYFLSYGFTLQAVIVWQQAKENG
FT                   QYGVAFSYRSQTKLV"
FT   CDS             323255..324445
FT                   /transl_table=11
FT                   /locus_tag="Y11_03151"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27866"
FT                   /db_xref="GOA:E7BAQ6"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ6"
FT                   /protein_id="CBY27866.1"
FT                   /translation="MEQTWRWYGPNDPVSLDDVRQAGATGVVTALHHIPNGQVWPVSEI
FT                   KQRQAEIAAKGLVWSVVESVPIHEEIKTHSGNYDQHIEKYQQTLRNLAECGIDIVCYNF
FT                   MPILDWTRTDLEYQLPDGSKALRFDQIAFAAFELHILKRPGAEKDYTAEEQAQAKAYFD
FT                   AMTEADIAKLTGNIIAGLPGAEEGYTLDQFRARLAEYDGIDKAQLRENMAYFLRAIIPV
FT                   AEQVGLRMAVHPDDPPCPILGLPRIVSTIEDMQWLKETVDSIHNGFTMCTGSYGVRADN
FT                   DLVKMIETFGDRIHFTHLRSTCREGNPKTFHEGGHLQGDVDMYSVVKAILTEEQRRQAA
FT                   GDRRPIPMRPDHGHQMLDDLHKKTNPGYSAIGRLKGLAEVRGVELALKRAFFPELK"
FT   CDS             complement(324722..325294)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03161"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27865"
FT                   /db_xref="GOA:E7BAQ5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011897"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ5"
FT                   /protein_id="CBY27865.1"
FT                   /translation="MARANEIKRGMAVNLNGKLLLVKDIDVQSPSARGASTLYKMRFSD
FT                   VRTGLKVEERFKGDEILDTITLTRRSVNFSYIDGDEYVFMDDEDFTPYNFKKEQIEEEL
FT                   LFIPEGGMPGMQVLTMDGQLLALELPQTVDMEIVETAPSIKGASASARNKPAVMSTGLS
FT                   IQVPEYISPGEKIRIHIAERRYMGRAD"
FT   CDS             complement(325354..325488)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27864"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ4"
FT                   /protein_id="CBY27864.1"
FT                   /translation="MRWLLSLTRITYLSKLIGICSIAAFLQLELFWVYSENLTLLGLA"
FT   CDS             complement(325524..326768)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03181"
FT                   /product="tryptophan-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27863"
FT                   /db_xref="GOA:E7BAQ3"
FT                   /db_xref="InterPro:IPR002091"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ3"
FT                   /protein_id="CBY27863.1"
FT                   /translation="MSMEVSQPLSRPSVLGGAMIVAGTAVGAGMFSIPIVTAGVWFSGS
FT                   VMLLIYTWACMLISGLMILEANLNYPSGASFHTMVQDLLGKVWSSINGVSITFVLYILT
FT                   YAYISAGGSIITHTLENIAGIGQTSAGFIFAVLVAFIVWLSTRAVDRLSTILIGGMVIT
FT                   FVMSVGDMFSHVESAVLFNQTDSNASYLPYALAALPYLLTSFGYHGNVPGLVKYYHKDG
FT                   KAVVRSLLYGTLIALVIYILWQYAIQGNIARDAFKQVIADGGNIGSLLKQMDTVSASQA
FT                   TGQLLNAFSYMALASSFLGVSLGLFDFIADFFKFTDDRGGRTKSALITFVPPTVGALLF
FT                   PNGFLYAIGFAGLAATIWAVIVPALMARASRKRFPQASYRAPGGRFMIGFIILFGLINA
FT                   VAHIAALMGLLPVYA"
FT   CDS             327235..327489
FT                   /transl_table=11
FT                   /locus_tag="Y11_03191"
FT                   /product="proteinase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27862"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ2"
FT                   /protein_id="CBY27862.1"
FT                   /translation="MDCRSDCGACCIAPSISSPIPGMPFGKPANTRCLHLDDNMLCGIF
FT                   HLPSRPAVCASLQALPEMCFDTREKALVYLIKLEADTAP"
FT   CDS             complement(327659..330139)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03201"
FT                   /product="trimethylamine-N-oxide reductase"
FT                   /EC_number="1.6.6.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27861"
FT                   /db_xref="GOA:E7BAQ1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ1"
FT                   /protein_id="CBY27861.1"
FT                   /translation="MTKYEQQPLQMSRRRFLLGTSALAALPLIGGLWPKSALAQAISQA
FT                   LPQFLALRQAQKGILTGAHWGAFEAIVENGRMVGVQPVKDDPWPNDLITMAPYQVHAEN
FT                   RIKYPMVRKSWLEGGPGSHTELRGRDEWVRVSWDKATELVCNEIVRVQKDHGPQALYAG
FT                   SYGWKSVGMLHNSRTLLQRLMNLSGGFLGYAGDYSTGAAQVIMTHVMGSMEVYEQQTAW
FT                   PNVVDNSELVILWGCNPMITLKNSWNVPDHVGQTGFEALKKKGTKVISIDPVHNDSAKF
FT                   TNAQWIAPRPYTDSAMLIGIAHTLLTEKLHNPDFIKTYTIGFDKFQAYLLGETDGQPKT
FT                   AEWAADISGVDADVIRQLARDMAKQRTMIMGGWGIQRQHHGEQQHWLLVTVASMLGQIG
FT                   LPGGGFGFSYHYSSGGSPTAKGGILPGISAGNAPKNSPSPIPVARIAECLANPGKTIDF
FT                   NGTKVTYPDVKMVYVAGGNTFHQHQDTNNLVKAWQHPETIVVNEPYWTATAKHADIVLP
FT                   ATTSYERNDLEMGGDYSQLYVFPMHQCVPPQHEARSDFDIFAAMATRLGVIDAFTEGKD
FT                   ETQWLKSMYDDMKSQARTARVALPPFDMFWESNNYIRFPIPEANKQWVRFADYRENPLL
FT                   NPLGTPSGKIEIYSDTIAKMEYADCQGIPTWMPPHEWYRGAEAKKYPLSLNTAHPINRL
FT                   HSQLDNTPLREKYAVADREAILISPQDASARQIVNGDLVRAFNDRGQILVGAVVTEDVR
FT                   PGVVRISEGAWFDPAEPSVPGSICKNGNINCLTFDIGSSSLAQGNCGQMAQLEIEKYTG
FT                   PVLKNTAHAVPAGA"
FT   CDS             complement(330153..331061)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03211"
FT                   /product="functional role page for Cytochrome c-type
FT                   protein TorY"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27860"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAQ0"
FT                   /protein_id="CBY27860.1"
FT                   /translation="MPHEPLDYLWTKIRAVKDIYGEMVGTINTPEKYEAHKLAMAQSVW
FT                   KTLKENDSATCRSCHSFDAMDITGQSAEARIQHPVAIKKGETCIDCHKGVAHILPDMSE
FT                   VTQAGAAELATAAAQTPATATTLYTIATEPFFMNAGDSHNAGNLMPSTEVEVVKQQGDQ
FT                   VLVDVKGWQQDGVAEVFYAAQGKRILSVLLGEDAQKALKTLNTQTDPETNLVWHQVALQ
FT                   VWLPKKQLVDDQQKIWRYAADMMSANCTGCHGLTALDRFNANQWIGVIKGMAPRTSLTQ
FT                   EQLRVMTQYVQKHASDMPAKL"
FT   CDS             331062..331253
FT                   /transl_table=11
FT                   /locus_tag="Y11_03221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27859"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP9"
FT                   /protein_id="CBY27859.1"
FT                   /translation="MAVSTFSADTFGVLEVDATLIFSQWLLHGVAGDAERGITGFMEDS
FT                   GSSSQERGTDNNADQQNP"
FT   CDS             complement(331602..332024)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03231"
FT                   /product="putative Mut family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27858"
FT                   /db_xref="GOA:E7BAP8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP8"
FT                   /protein_id="CBY27858.1"
FT                   /translation="MSVVVGVGVIIVNQQGEVLFGKRSSQHAPYWSIPGGHMEAGESFE
FT                   QAAQREIFEETGLNINEMKVIGLCNNLATWRKEGKHTVSVCLLTQHPGGQPELKEPDKC
FT                   QQWLWCNPRELPEPHFEASRHAIDLWLNQQFYFPYD"
FT   CDS             332285..333418
FT                   /transl_table=11
FT                   /locus_tag="Y11_03241"
FT                   /product="fructose-specific phosphocarrier protein HPr; PTS
FT                   system, fructose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27857"
FT                   /db_xref="GOA:E7BAP7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP7"
FT                   /protein_id="CBY27857.1"
FT                   /translation="MFQLSTQDIHLAAQADSKNEAITQVAAALTQAGNVAAGYLDGMLA
FT                   REQQTSTYLGNGIAIPHGTTDTRDLVLNTGVQVFQFPQGITWGEDQIAYIVIGIAARSD
FT                   EHLALLRQLTHVLSDDAVAAQLAKTTSAEELRSLLMGEKKTAEFHFDTSLIALDVAADN
FT                   LITLQALNAGRLQQIGAVDARFVSDVITREPLNLGQGIWLSDSTEGNLASAATVSRPAS
FT                   AFEHNGEKVALLLTLSVVDDQPFSVLNYLSDLLLAKKADLLLNADAAALLALLTSEHIE
FT                   QNEVLSAEFVVRNEHGLHARPGTFLVNTIKQFTSEITVTNLDGTGKPANGRSLMKVVAL
FT                   GVKKGNRLRFTASGEDAQAALDAIGEAIAAGLGEGAA"
FT   CDS             333415..334353
FT                   /transl_table=11
FT                   /locus_tag="Y11_03251"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27856"
FT                   /db_xref="GOA:E7BAP6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP6"
FT                   /protein_id="CBY27856.1"
FT                   /translation="MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTAGLHAAGKGINV
FT                   AKVLKDLGIDVTVGGFLGKDNQDGFQLLFSELGIANRFQVVPGRTRINVKLTEKDGEVT
FT                   DFNFSGFEVTKPDWDRFVNDSLSWLGQFDMVAVSGSLPAGVNPDDFTDWMKRLRSQCPC
FT                   IIFDSSREALVAGLKASPWLVKPNRRELEIWAGRPLPELGDVVEAAHALRDQGIAHVVI
FT                   SLGAEGALWVNASGAWLAKPPACDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAV
FT                   AALAVSQSNVGITNRPQLAAMMAKVDLKPFN"
FT   CDS             334368..335051
FT                   /transl_table=11
FT                   /locus_tag="Y11_03261"
FT                   /product="PTS system, fructose-specific IIB component; PTS
FT                   system, fructose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27855"
FT                   /db_xref="GOA:E7BAP5"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP5"
FT                   /protein_id="CBY27855.1"
FT                   /translation="MKTLLIIDSSLGQARGHLASLMLGAAAAKAGLSWVEKAADAELVI
FT                   VAGQAIPADRALNGKKLYLGDVEKAVRDPEGFLAQAIAQAKPYQAVAAATPVTATGPKR
FT                   IVAITACPTGVAHTFMAAEAIESEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIV
FT                   AADIEVDLDKFAGKPMYRTTTGLALKKTAQELDKALVEAEVYQPKTGSSTGSKKQKPAA
FT                   LIVIC"
FT   CDS             335066..336046
FT                   /transl_table=11
FT                   /locus_tag="Y11_03271"
FT                   /product="PTS system, fructose-specific IIB component; PTS
FT                   system, fructose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27854"
FT                   /db_xref="GOA:E7BAP4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP4"
FT                   /protein_id="CBY27854.1"
FT                   /translation="MLPMVVAGGLCIALSFVFGIKAFEVKGTLAAALMQIGGGSAFALM
FT                   VPVLAGFIAFSIADRPGLTPGLIGGMLAVSTGAGFLGGIIAGFLAGYVAKAISTKLHLP
FT                   QSMEALKPILIIPLVASLIVGLVMIYVVGTPVAKIMTGLTNWLQSMGTANAVLLGAILG
FT                   AMMCTDMGGPVNKAAYAFGVALLSSSVYAPMAAIMAAGMVPPLAMGLATLLARHKFDKG
FT                   EQEGGKAALVLGLCFISEGAIPFAARDPMRVLPCCIAGGALTGALSMAFGAQLMAPHGG
FT                   LFVLLIPGAIHPVLLYLVAIIAGTVLAGGLYAMLKRPDTAVAKVV"
FT   CDS             336312..336977
FT                   /transl_table=11
FT                   /locus_tag="Y11_03281"
FT                   /product="protein psaE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27853"
FT                   /db_xref="GOA:E7BAP3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP3"
FT                   /protein_id="CBY27853.1"
FT                   /translation="MSSSVVLDKLKNVLMINNEAHALSKNEVLLLEYLYLRGGEVIPRD
FT                   ELISHCWPDRVVSAVSLPVAIKHIRDVLRKATLNEVIKTHKSVGYSLQKDSLELVIYSL
FT                   AYEQPANNLALNHVAADENIDVQRQPQQSTKVRQRFRHNYVDYFMAIAIVIAITLFIIG
FT                   GDDIISITDSRTHNTIITNLPPVLAYTAAPLPKVKNSLIFKDDFGSVIVCNKSECKSQ"
FT   CDS             337160..337465
FT                   /transl_table=11
FT                   /locus_tag="Y11_03291"
FT                   /product="protein psaF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27852"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP2"
FT                   /protein_id="CBY27852.1"
FT                   /translation="MILSEEMSGVSLRKPWGGFVFFPLHSYQSAPSGQPKGSLKSLGSP
FT                   LSVCIYEVDNQKKNIVSFFHGDRGFIEINGETIHLSSLFLGLQGKHIHASYRSLSE"
FT   CDS             337726..338205
FT                   /transl_table=11
FT                   /locus_tag="Y11_03301"
FT                   /product="ph 6 antigen adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27851"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP1"
FT                   /protein_id="CBY27851.1"
FT                   /translation="MNMKKFVKKPLAIAVLMLASGGMVNMVHAEPTVINSKDISATKTV
FT                   KEGGSFSVEFKATENEIVSGKLDADTPAFHLVMSDSGEHKGWNVRPTGASEGGQMVSAD
FT                   GTRVDLHTNELSWDNDHWWIDDGSERVEATFFLAAGDEVKAGEYQFTGRVEEYVE"
FT   CDS             338338..338802
FT                   /transl_table=11
FT                   /locus_tag="Y11_03311"
FT                   /product="chaperone protein psaB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27850"
FT                   /db_xref="GOA:E7BAP0"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAP0"
FT                   /protein_id="CBY27850.1"
FT                   /translation="MKYKFSHNFISYNLFLFVFMSLILLPYSHASSMGFNTSQHKFSVR
FT                   TGETRIIYPLSSVKGVSLSVTNPQDYPILVQTQVKGEDKHSPAPFMATPPLFRLDAGMR
FT                   GRVRVTRTGGNFPEDRESLQWLCITGVPPKEGDVWDNSQHDKKTICKMLI"
FT   CDS             338829..339140
FT                   /transl_table=11
FT                   /locus_tag="Y11_03321"
FT                   /product="chaperone protein psaB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27849"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN9"
FT                   /protein_id="CBY27849.1"
FT                   /translation="MKLLVRPDQLRQKPEEMAGKLIWHRNGQQLQVNNPTPFYMNFKSV
FT                   SLGNKNIKLSSAGNENYVAPFAERSFSLPVDMAEAPAEINWQIINDLGSESQVFKANI"
FT   CDS             339191..341716
FT                   /transl_table=11
FT                   /locus_tag="Y11_03331"
FT                   /product="outer membrane usher protein psaC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27848"
FT                   /db_xref="GOA:E7BAN8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN8"
FT                   /protein_id="CBY27848.1"
FT                   /translation="MFFSLKNSVAKLIAFWAICLVLPVWAGHYTFDPILLANNNINANA
FT                   NTDLSLFEQGGQLPGTYQVDIFLGDEKMDSTNVTFHAVKSPTGEYSLQSCLTKEQLSRY
FT                   GVDVDNYPELLPPEKNIQQDKQASQCVNLAAIPQASEEFEFYAMRLVLNIPQVALRPKD
FT                   EIPVERWDDGITAFLLNYMANSSTTTYRQTGEQQSSHYVQLYPGFNIGAWRIRNATSWN
FT                   QSGNSAGKWQSSYIYATRGLYRLKSRVTLGQSYTPGDFFDSVPFSGVMLGDDDNMLPSS
FT                   QRDFIPVVRGIARSQARVEVRQNGYLLYSTVVSPGPFELTDILPSHSNGDLHVTVLESN
FT                   GTTQQFTVPYSVPAIALRKGRLRYNLMAGRYRPANVDVETTPIAQATVAYGLPWNLTAF
FT                   VGGQWSPHYQATTAGMGVMLGDYGALSSSITQATSEYRQQQPVKGQVWEVRYNKTLQAS
FT                   DTSFSVVNSQYSTADFSNLSDVLQSYRRHDYSRRDWHSNSLRNQTHVVVGQPLGQFGYL
FT                   NLNWSRQSYRDAPASSSWGAQYSFNIGNLYCSLDWTQNQYRGNQDRLLSLSVSMPLGRE
FT                   RDTYAAYRMTSSDNSKDHEMSLYGHAFDNRLSWNVRQTERYAQFHSGENSGSLGLDWQG
FT                   SYGDIGGNYYYTPTIRQFSANVSGGAVIHRHGLTLGPQINGTAALVEVPGVSGVSTSED
FT                   HRLKTDFRGYSIVPNIFPYEEHDILLETTDLPPDAEVTKTDAKVLPTEGAIVRASFSPQ
FT                   IGARALMTITRNNGETIPFGAMASLVNQPANAAIVDEGGKAYLTGLPETGQLLVQWGRG
FT                   ASQQCRVDYQLANAKKGDAGLYMLSGVCH"
FT   CDS             complement(341784..342629)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03341"
FT                   /product="endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27847"
FT                   /db_xref="GOA:E7BAN7"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN7"
FT                   /protein_id="CBY27847.1"
FT                   /translation="MKFVGAHVSAAGGVDQAVIRAHELEATAFALFTKNQRQWRAAALA
FT                   EDVIEKFKQACEQYGYTSAQILPHDSYLINLGHPVTEALEKSREAFIDEMMRCQQLGLS
FT                   LLNFHPGSHLLQIDEDKCLVRIAESINIALDATEGVTAVIENTAGQGSNLGFKFEHLAA
FT                   IIDGVEDKSRVGVCIDTCHAFAAGYDLRTEADCEHTFNQFGEIVGFQYLRGMHLNDAKS
FT                   EFNSRVDRHHSLGEGNIGKTVFSYIMRDPRFDNIPLILETVNPDIWAEEIAWLKSQAEI
FT                   "
FT   CDS             complement(343118..344200)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03351"
FT                   /product="putative membrane protein YeiH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27846"
FT                   /db_xref="GOA:E7BAN6"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN6"
FT                   /protein_id="CBY27846.1"
FT                   /translation="MATSHTTELSRPQLPALFRYIPGLVLTGVITGLALKVGDMPWFID
FT                   MGLGALTLAILFGIVVGNTLYPWVQPVYSDGVVLAKQHLLRLGIILYGFRLTFQQVADV
FT                   GATGMIIDLLTLGSTFILACWLGKRVFGLDQQTVMLIGAGSSICGAAAIMATEPVLKAD
FT                   ASKVAVAVATVVIFGTLAIFVYPWLYQLNLHYQWLPFNQETFGIFAGSTIHEVAQVVAA
FT                   GHAIGPDAENAAVITKMIRVMMLAPFLLLLSAYLGRSSLKASGQKREKSAITIPWFAVI
FT                   FILMAGFNSLNLLPAAWVSHLITLDTILLAMAMAALGLTTHVGSIRQAGVKPLLLALML
FT                   FAWLLIGGTGINLLVQHIAG"
FT   CDS             complement(344921..346186)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03361"
FT                   /product="cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27845"
FT                   /db_xref="GOA:E7BAN5"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR026864"
FT                   /db_xref="InterPro:IPR027017"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN5"
FT                   /protein_id="CBY27845.1"
FT                   /translation="MSHEQQSAAFKFLMRHYFGLEGEDPSPWNKNYINRVLSSTVSSNT
FT                   GAAAEKLSKSIAQFTHSDARYYGENFLLLGSEWKKQMRQLASVPIADRYHHILRAIAIK
FT                   ETAVRFLPTSYPAFGDPEQPGQGYPFDMLQDSALHPGEPLYIAGVTQDKSWSFIVSPSV
FT                   IGWVDSSDIANADDAFIQHWISMAKAGLVAVINDNASFVDQEKIFRFTARTGTLLPLKT
FT                   VTGIKTDADKIAVAIPVKNKYGKTNIHYAHLSKESIQQVPVIPTPKTLSSLIKNMQGKN
FT                   YGWGNIYGFNDCSAEIRNLMLPLGIYLPRDAQQQSLSGKSIDLSHYSTAERIDYLMKHG
FT                   KPFTTLIYIGGHVMLYIGNIDWKGQAVPVTYQNLWGLRPADSSSRSIIGKSVFFPLLSH
FT                   YPQDPKLESLAGKPTFIVTWLN"
FT   CDS             346503..346799
FT                   /transl_table=11
FT                   /locus_tag="Y11_03371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27844"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN4"
FT                   /protein_id="CBY27844.1"
FT                   /translation="MKRKRVKSEKSLWVILIIAAMIYLLAPPYLIAYFFKLYNLNPFHI
FT                   TPIPHFNPFKSERGIPLSHTFSYLFVIWLIFNVVIGGGATIIYHLFLRGNENK"
FT   CDS             347096..347968
FT                   /transl_table=11
FT                   /locus_tag="Y11_03381"
FT                   /product="lysr family transcriptional regulator YeiE"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27843"
FT                   /db_xref="GOA:E7BAN3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN3"
FT                   /protein_id="CBY27843.1"
FT                   /translation="MHITLRQLEVFTEVLKSGSTTQASVVLALSQSAVSAALADLEGQL
FT                   GVQLFDRVGKRLVTNEHGRLLYPKALALLEQAIEIEQLFQQDLGALRIAASSTIGNYML
FT                   PGMIAKYRRDFPGTPLELNIGNSQDVIEAVADFRGDLGLIEGPCHMPELMTQAWLRDEL
FT                   VVFAAPDNPLCHKMLTLEELADAAWILRERGSGTREVLDHLLLAKLPHFKLVMELGNSE
FT                   AIKRAVRYGMGISCLSRRVIADQLANGELIELNIPLSPLIRTLYLIHHRQKHISNALQR
FT                   FLSYCQEEP"
FT   CDS             348213..349739
FT                   /transl_table=11
FT                   /locus_tag="Y11_03391"
FT                   /product="lysine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27842"
FT                   /db_xref="GOA:E7BAN2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN2"
FT                   /protein_id="CBY27842.1"
FT                   /translation="MTQQNTKIPVQQGAQRLRRELKSRHLAMIAIGGSIGTGLFVASGA
FT                   TVSQAGPGGALLSYALIGLMVYFLMTSLGELAAFMPVSGSFSTYGSKYVEEGFGFALGW
FT                   NYWYNWAVTIAVDLVAAQLVMNYWFPDAPGWIWSALFLALMFLLNYISVKGFGEAEYWF
FT                   SLIKVTTVIIFIIIGVMMISGIMKGGESAGWHNWTIGDAPFAGGFSAMIGVAMIVGFSF
FT                   QGTELIGIAAGESKDPGKNIPRAVRKVFWRILLFYIFAILIISLIIPYTDPSLLRNDVK
FT                   DISVSPFTLVFQNAGLLSAAAVMNAVILTAVLSAGNSGMYASTRMLFTLASEGKAPRIF
FT                   AKLSRGGVPRNALYATTVVAGLCFLSSMFGNQTVYLWLLNTSGMTGFIAWLGIAISHYR
FT                   FRRGYMMQGRDLNDLPYQSGFFPLGPIFAFVLCLIITLGQNYQAFLQDRIDWYGVTATY
FT                   IGIPLFLVIWFGYKLSRGTKVIKYKDMEFPKWRDESHDDQEAKKTALIAD"
FT   CDS             350014..351096
FT                   /transl_table=11
FT                   /locus_tag="Y11_03401"
FT                   /product="iron(III) dicitrate transport system permease
FT                   protein FecD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27841"
FT                   /db_xref="GOA:E7BAN1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN1"
FT                   /protein_id="CBY27841.1"
FT                   /translation="MSLSTESMTETSHQIDADVMGRYKNIVRHRLLIMGVLVLAIFGCL
FT                   LLDFTMGPSGLTLSSLWQTLIDPASADAGTRVIVWDIRLPYALMAVVIGLSLGLAGAEM
FT                   QTILNNPLASPFTLGVSSAAAFGAALAIVSGIGIPGVPDQWFISVNAFIFALFAALMLD
FT                   GITRWTRVATSGVVLFGIALVFTFNALVSMMQFIASEDTLQGLVFWTMGSLARASWAKL
FT                   GIMLVVFALMLLLSMMSSWKLTALRLGEDRAISFGIDVRRLRLGTLLRISMLSALAVAF
FT                   VGPIGFIGLVAPHIARMIFGEDHRFYLPASALIGALVLSMASIASKNLIPGVIIPVGIV
FT                   TSLVGVPFFLSIILRHRGNV"
FT   CDS             351093..351881
FT                   /transl_table=11
FT                   /locus_tag="Y11_03411"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27840"
FT                   /db_xref="GOA:E7BAN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAN0"
FT                   /protein_id="CBY27840.1"
FT                   /translation="MTSGLRIEHFNAGYPKRPVIQNLTVPLLPRGKITVLLGPNGSGKS
FT                   TLLRSMAGLNRAQGQLWLDNNDLMQMPFAQRAEKVVYLPQSLPAGVHLHVLESIIVAQR
FT                   ASGGRSNASSEAEVMVLLEQLGIAHLALSYLDQLSGGQKQLVGLAQSLIRQPSLLLLDE
FT                   PLSALDLNYQFHVMDLVRKETRKRNIITVVVVHDINIALRHGDHVLMLQNGTLIADGLP
FT                   EEVITPQSLAKVYGVKGRIERCSQGIPQVLIDGLVTEPTI"
FT   CDS             352105..354078
FT                   /transl_table=11
FT                   /locus_tag="Y11_03421"
FT                   /product="TonB-dependent receptor; Outer membrane receptor
FT                   for ferrienterochelin and colicins"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27839"
FT                   /db_xref="GOA:E7BAM9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM9"
FT                   /protein_id="CBY27839.1"
FT                   /translation="MAKAFRKSNAAALVIATIISSQASAAETTATDTMVVTASGFQQRI
FT                   QDSAASISVVTREQIENKAYTDITDALKDVPGVVVTGGGSHSDISIRGMSAKYTLILVD
FT                   GKRVDTRGTRPNSDGSGIEQGWLPPLAAIERIEVVRGPMSSLYGSDAMGGVINVITRKV
FT                   GKEWHGTVRAEATLQEDSNSGDIYQTNAYASGPLIDGLLGLKVSGLLSHRSEDKIIDGY
FT                   NEQRLRNGAATFTLTPDDKNEFDFDIGHYVQDRNTTAGRSVALNGKSRDVQYDRNNYAI
FT                   THHGYYDFGNSTSYVQRDETRNPSREMKSVDNIFNSQTSFLFDSHTLILGGQYRYEELY
FT                   DEGNQLASAKDLTKLTRGSWALFAEDEWQMTNDFALTGGIRMDQDENYGTHWTPRLYGV
FT                   WHLSEQWTLKGGVSGGYRSPDLRQATDNWGQITGGKGDPAIIVGNSSLKPERSISEEIG
FT                   VLWDNQEGINAGVTLFNTDFKDKITEVRRCTDTAGKASGQCMINGNSYKFISDRTNVDK
FT                   AMIRGVEATFGWDISKDWSLTSNYTFTQSEQKSGQFSGKPLNQMPKHMLNATLNWQATE
FT                   DLATWIRANYRGKTSEYLNRTSIGTTTPSYTFVDLGANYQLTKEFRLMGGVYNLLDKRV
FT                   DIEVNDKVLDGRRYMVGASYDF"
FT   CDS             complement(354626..355246)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03431"
FT                   /product="uncharacterized glutathione S-transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27838"
FT                   /db_xref="GOA:E7BAM8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM8"
FT                   /protein_id="CBY27838.1"
FT                   /translation="MLTVWGRNNSTNVKKVLWCLEELGVSYERVDVGGQYGKLNDPLYR
FT                   SLNPNGLIPCLQDGDFILWESNTIVRYLAAQYGDNALYLPEAKQRAAAEKWMDWATSSV
FT                   VEPFKAVFIGLVRTAPELQDKAKIAHGIDQLNALMAIADEALSKQIYLSGDKFGIGDIP
FT                   LGCLAYAWFNLPIERPELPHLQRWYQSLTHRTAFQKVIDIGLS"
FT   CDS             complement(355265..355924)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03441"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27837"
FT                   /db_xref="GOA:E7BAM7"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM7"
FT                   /protein_id="CBY27837.1"
FT                   /translation="MDLALFDLDETLISDDSSGLWLRWLVDQGLAPLELAEQEQYLMKQ
FT                   YYQGSLSMSCYMESTLSPLVGKHTAEVGGWVERFIERDILPRVYPQARKLMNWHRNRGD
FT                   YIVIISATGEHLVTPIAQQLSANAALSIGVEVENSRYTGKTYGTLTYREGKVERLKQWL
FT                   TESPQLDFQRSYGYSDSINDKPLLEYVDRAAVINPGTELVDLAILHHWDIHHWQRR"
FT   CDS             356300..356422
FT                   /transl_table=11
FT                   /locus_tag="Y11_03451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27836"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM6"
FT                   /protein_id="CBY27836.1"
FT                   /translation="MLIIRLYGCPVFIGSEQKKQPTEHPGVKNESPTLKQSIAS"
FT   CDS             356385..357461
FT                   /transl_table=11
FT                   /locus_tag="Y11_03461"
FT                   /product="2-oxobutyrate oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27835"
FT                   /db_xref="GOA:E7BAM5"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM5"
FT                   /protein_id="CBY27835.1"
FT                   /translation="MSHQHLSSQSPVNADTLPLLDLSLLNGNETERQAFLDVLRHAARD
FT                   IGFFYLTGHGIDPVLLQQIQTLSREFFALPDEEKLAVAMVHSPHFRGYNRAASELTRGQ
FT                   PDWREQFDIGAERTPLPQTPGTPSWARLQGPNQWPEALPELKPTLLQWQREMTGMALRL
FT                   LRAFALSLNLDENAFDELYGDKPNEHIKLIRYPGRETTQSGQGVGAHKDSGFLSFLLQD
FT                   QQRGLQVEVEEGRWIDAVPRPDTFVVNIGELLELASNGYLRATVHRVETPPAGTDRLSI
FT                   AFFLGARLDAVVPLYPLTAELAAEARGPASDPDNPLFRDVGLNYLKGRLRSHPDVAERF
FT                   YPEAIVPTEATATVSTNY"
FT   CDS             357511..358338
FT                   /transl_table=11
FT                   /locus_tag="Y11_03471"
FT                   /product="methionine ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27834"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM4"
FT                   /protein_id="CBY27834.1"
FT                   /translation="MMTKTRISGLVRTAVLTALTSTFTLSAQAAEALRVAADPVPHAEI
FT                   LQFVQKLDPSLNLKVIEIPNGVNSNELLAHGDVDAKYFQHVPYLHSQEQALGQKFAVAA
FT                   TVHIEPLGVYSHKHKTFADVPDKGTVAVPNNVTNLSRALYLLQDQGLITLKPGFTDPAK
FT                   NQATPKDIASNPKHLKILEIESPQIPRSLDDVDLAVINGNYALEAGLNPAKDALGLEKA
FT                   AGNPYANILVTTPALENDQRIKQLAKDLQSPEVAKFITEKYAGSVIPVAGIKS"
FT   CDS             358335..359321
FT                   /transl_table=11
FT                   /locus_tag="Y11_03481"
FT                   /product="methionine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27833"
FT                   /db_xref="GOA:E7BAM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM3"
FT                   /protein_id="CBY27833.1"
FT                   /translation="MISIERLSKTYTQGGLPMVALEEVSLEIPTGSVFGIIGRSGAGKS
FT                   TLIRCLNLLERPTSGRIQVDGHELTTLSDRQLRLQRQNIGMIFQNFHLLHSRNVWDNIA
FT                   VGLEIIGMPKAQRQTRVAALLDLVGLGDKAHAFPSQLSGGQKQRVGIARALAAKPSYLL
FT                   SDEATSALDPETTASILALLSDINRQLGLTIVLITHELDVVKSICDTAALLERGRVVET
FT                   GAIADLLSSPHSRLGRSLLPARGPASLSGAPVAELTFFDTVSASPVLSELAQRHAVGVT
FT                   LLGGGVESIGGQRVGRLQVDFSHPDGGLNLAEVLQFLNERGVRAELI"
FT   CDS             359318..359989
FT                   /transl_table=11
FT                   /locus_tag="Y11_03491"
FT                   /product="methionine ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27832"
FT                   /db_xref="GOA:E7BAM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM2"
FT                   /protein_id="CBY27832.1"
FT                   /translation="MNSGMSWQELLELIANATGETIYMVVIATFFTILIGLPLGVLLFV
FT                   SRPNGVLPAPRVNTLVGAIVNLGRSMPFVVLLIALIPITRWIIGTTLGSTAAIVPITLG
FT                   AIPFFARVVEAALDEVDKGRIEAILSMGGSARHVVQKVLLPEALPALLAGVTLTVVMLV
FT                   GFSSMAGVIGGGGLGDLAIRYGYQRFNNEVMVATLVILVILVQGVQSLGDRWVRSLAHR
FT                   R"
FT   CDS             complement(360106..361251)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03501"
FT                   /product="cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27831"
FT                   /db_xref="GOA:E7BAM1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM1"
FT                   /protein_id="CBY27831.1"
FT                   /translation="MAKFDTLTVHAGYTPDSTGAVMPAIYATSTFAQPAPGEHTGYEYS
FT                   RSGNPTRTALEKAIAELEGGIRGYAFASGLAACSTVLELLDQGSHIIAVDDLYGGTYRL
FT                   LEKVRSRTAGLRVTYVSPADTAALEQAILPDTKMIWVETPTNPLLKLADLTAIAAIAKK
FT                   HQLISVADNTFASPYIQRPLDLGFDIVVHSATKYLNGHSDVVAGVAAVGNNPELAEQLG
FT                   FLHNAVGGILDPFSSFLTLRGLRTLALRMARHNDSAQRIAEWLEQQPPVENVYYPGLKN
FT                   HPQHALAAKQMAGFGGMISVRLKGDDEFARAVIQRSHLFTLAESLGGVESLISQPYSMT
FT                   HASILLETRLKHGITPQLLRLSVGIEDTEDLIADLDQALNG"
FT   CDS             complement(361277..362644)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03511"
FT                   /product="cystathionine beta-synthase"
FT                   /EC_number="4.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27830"
FT                   /db_xref="GOA:E7BAM0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAM0"
FT                   /protein_id="CBY27830.1"
FT                   /translation="MAIPRSVLDLIGHTPLLELTRFDTGPCQLFVKLENQNPGGSIKDR
FT                   VALSMIEQAESDGLLQPGGTIIEATAGNTGLGLALVAALKGYKLILVVPDKMSQEKIFH
FT                   LRALGAQVLLTRSDVGKGHPAYYQDYALRLAQETPGSFYIDQFNNPANPAAHRTSTGPE
FT                   LWQQMGEQIDAIVVGVGSSGTLSGLSHYFSEVSPTTEFVLADPAGSILADFVDSDRIGD
FT                   AGSWLVEGIGEDFIPPLSNFSQVKKSYRIDDAEAFSTARTLLREEGVLAGSSTGTLLAA
FT                   ALRYCREQTTAKRVMTFVCDSGNKYLSKMFNDYWLLEQGLLSKPQLGDLRDYITYSHED
FT                   GATISVSPEDTLAVAHARMRLYDISQLPVLDGEKVVGLIDEWDLLNAVQADASHFKHPV
FT                   SSAMTRQVKTLQKEANYRSLLTTFNDGHVAVVLDGERFLGLITRTDVLNTWRQKLA"
FT   CDS             363064..364254
FT                   /transl_table=11
FT                   /locus_tag="Y11_03521"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27829"
FT                   /db_xref="GOA:E7BAL9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL9"
FT                   /protein_id="CBY27829.1"
FT                   /translation="MKFIPPFKLKKLTFSAGLLLLALPYAHAADSPAAPAIDAKAYVLM
FT                   DYNSGKVLAEGNSDQRLDPASLTKIMSSYVIGQAIKAGKVHPDDLVTVGKDAWATGNPA
FT                   LRGSSLMFLKPGDQVKLSDLNKGIVIQSGNDASIALADYIAGSQDSFVGLMNNYAKALG
FT                   LNNTNFMTVHGLDAPGQYSTAHDMAVLGQALIRDVPDEYALHKEKEFTFNKIRQINRNR
FT                   LLWSTNLNVDGMKTGFTAGAGHNLVASATDGPMRLISVVLGAPSDRVRFSESEKLLTWG
FT                   FRFYETVVPIKATKPFVAQKVWFGDTGQAELGVAEDAAITIPKGQMKNLKASYKLNETE
FT                   LRAPLAKHQVVGTIDFQLNGKTIDQRPLVVLNEVKEGGFFSRIWDFVMMKISQLFS"
FT   CDS             364567..365616
FT                   /transl_table=11
FT                   /locus_tag="Y11_03531"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27828"
FT                   /db_xref="GOA:E7BAL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL8"
FT                   /protein_id="CBY27828.1"
FT                   /translation="MLKLRRRSVHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKTQPACQ
FT                   RVMKVPGVGSMTATYLVASVGNGQQFHSAKQFAAWLGLVPREFSSGGKQRLGRISKRGD
FT                   RYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHH
FT                   TEYRTLSAV"
FT   CDS             complement(366024..367391)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03541"
FT                   /product="L-serine dehydratase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27827"
FT                   /db_xref="GOA:E7BAL7"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL7"
FT                   /protein_id="CBY27827.1"
FT                   /translation="MVSVFDIFKIGIGPSSSHTVGPMKAGKLFTDDLIALEHLSAITRV
FT                   TVDVYGSLSLTGKGHHTDIAIIMGLAGNLPDTVDIDAIPGFIRDVAARERLLLANGSHE
FT                   VDFLANGGMNFHETNLPLHENGMTISAHAGDNCIFSKTYYSIGGGFIVDEAHFGQQDSN
FT                   AVTVPYPFNSARDLQKHCKDTGLSLSGLVMQNELALHSKAEISAHFAAIWDVMRAGIER
FT                   GINTEGLLPGPMKVPRRAAALRRMLVTTDKHNADPMMVVDWINMYALAVNEENAAGGRV
FT                   VTAPTNGACGIIPAVLAYYDKFIRPVNENSYSRYFLVAGVIGALYKMNASISGAEVGCQ
FT                   GEVGVACSMAAAGLAELMGGSPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIS
FT                   AVQAVNSARMALRRTSEPSVCLDKVIETMYETGKDMNSKYRETSRGGLAIKVVACH"
FT   CDS             complement(367537..368832)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03551"
FT                   /product="serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27826"
FT                   /db_xref="GOA:E7BAL6"
FT                   /db_xref="InterPro:IPR004694"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL6"
FT                   /protein_id="CBY27826.1"
FT                   /translation="MDTTQTGTIASSGKTPSSTWRKSDTMWMLGLYGTAIGAGVLFLPI
FT                   NAGIGGLLPLIVMAIIAFPMTFYAHRGLCRFVLSGKNPGEDITEVVEEHFGQGAGKLIT
FT                   LLYFFAIYPILLVYSVAITNTVDSFITHQMHLPSPPRAILSLILIIGLMTIVRFGEHAI
FT                   VKAMSILVFPFVAVLMLLAVYLIPNWSSAIFEHVSMDGNGTGSGLWMTLWLVIPVMVFS
FT                   FNHSPIISAFAVAKREEYGVDAEKKCSRILAFAHIMMVVTVMFFVFSCVLSLSPADLAE
FT                   AKSQNISILSYLANHFNTPMIAYMAPVIAFIAITKSFLGHYLGAREGFNGMMIKSLRSK
FT                   GKEINHDKLNRITALFMLVTTWIVATMNPSILGMIETLGGPIIAMLLFLMPMYAIHKVP
FT                   AMRKYSGKVSNVFVVIMGLIAISAILFSLFGK"
FT   CDS             complement(370092..370856)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03561"
FT                   /product="deoxyribose operon repressor, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27825"
FT                   /db_xref="GOA:E7BAL5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL5"
FT                   /protein_id="CBY27825.1"
FT                   /translation="METRRAERINKLTQALKRSDKIHLKDAANLLRVSEMTIRRDLSAE
FT                   PTSVILLGGYVVMDPKSNNANNYFVSDQQAKQVEEKRLIGQLAARLIVENDTVFFDCGT
FT                   TIPSIIDEIDEELSFTAICYSLNTFLSLQDKPNCKVILCGGEFKPNNYIFTPISQHNEL
FT                   DNACPNKAFISAAGVSIEYGATCFNFDEILLKHRAIAKSQHKILVADHSKFGKIKPASI
FT                   GALTLFDAIVTNCQPDSEFNQFFLQHNIKTYC"
FT   CDS             complement(371044..371715)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03571"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27824"
FT                   /db_xref="GOA:E7BAL4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL4"
FT                   /protein_id="CBY27824.1"
FT                   /translation="MTINYANYIDHTLLAMDATEEQIIKLCGEAKQHHFYAVCVNSGYV
FT                   PVAAQQLAGTSVKVCSVIGFPLGAGLTEAKAFEAQAAIKAGAQEIDMVINVGWLKSGKI
FT                   AEVKADIKAVRDNCASTPLKVILETCLLSDAQIVQVCEMCRELDVAFVKTSTGFSTGGA
FT                   KEDHVKLMRATVGQDMGVKASGAVRDRATAETMIKAGATRIGTSSGVAIVSGQQASASS
FT                   Y"
FT   CDS             complement(371990..372598)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03581"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27823"
FT                   /db_xref="GOA:E7BAL3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL3"
FT                   /protein_id="CBY27823.1"
FT                   /translation="MIEQMNYFFFSMINATPASSTWMISFATFIARDLIMIIPILLVGM
FT                   WLWGPQSDMDSQRALVTKAAIALAFSMLSASCIGMLIPHDRPFVVGFGYNFMNHAPDSS
FT                   FPSDHGTAIFTFALTFVFWHKLWSAVSLMAVAVAIAWSRIYLGVHWPLDMVGGFLLGIV
FT                   GCLFAQLVWNLFGDAISNGLKRLYQVGFALPISRGWVRN"
FT   CDS             complement(372595..373227)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03591"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27822"
FT                   /db_xref="GOA:E7BAL2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL2"
FT                   /protein_id="CBY27822.1"
FT                   /translation="MISGLLFLWLSRDEQLDWLISNYWFDPASQHFPWKNNYWLDLLNH
FT                   RLLKITIISVAVVTLLWGLYRRNKRVVTTMLLFGIGPLVIGVLKATSAHSCPWDLVEYG
FT                   GKSLSYVLMGTAPVGAGPGHCFPGGHASSGFAVMALFFLFYPERPRWALLCWFAGATLG
FT                   MLMGFGQIMRGAHFLTHNLWAGWWVWLSQLAVYWMISGFYNRDKGKE"
FT   CDS             complement(373638..375326)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03601"
FT                   /product="trka, Potassium channel-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27821"
FT                   /db_xref="GOA:E7BAL1"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023017"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL1"
FT                   /protein_id="CBY27821.1"
FT                   /translation="MNINVANLLNGNYILLLFVVLALGLCLGKLRLGPIQLGNAIGVLV
FT                   VSLLLGQQHFTINTEALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAM
FT                   VLALGLGKLFGWDIGLTAGMLAGSMTSTPVLVGAGDTLRHTIANNPALQHAQDNLSLGY
FT                   ALTYLIGLVSLILGARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGP
FT                   ELVAWADGKNLRELGIYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSR
FT                   LDPSFRNGKEVFDRDLLDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIE
FT                   MPIDDNVVLNKGDVLQVSGDARRVKSVAEKIGFISIHSQVTDLLAFCAFFILGLMIGLI
FT                   TFQFSNFSFGIGNAAGLLMAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGL
FT                   SAGGGINSNLGAVGGQMLISGLIVSLVPVVICFIFGAYVLRMNRALLFGAIMGARTCAP
FT                   AMDIISDTARSNIPALGYAGTYAIANVLLTLAGSLIVIVWPGILG"
FT   CDS             complement(375735..375998)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03611"
FT                   /product="glutaredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27820"
FT                   /db_xref="GOA:E7BAL0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011902"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAL0"
FT                   /protein_id="CBY27820.1"
FT                   /translation="MFAVIFGRPGCPYCVRAKELAEKLETERDDFKFRYIDIHAEGITK
FT                   ADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAKENLSLFQ"
FT   CDS             376313..376621
FT                   /transl_table=11
FT                   /locus_tag="Y11_03621"
FT                   /product="hypothetical protein; Some similarities with
FT                   putative membrane protein YbjC of Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27819"
FT                   /db_xref="InterPro:IPR010815"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK9"
FT                   /protein_id="CBY27819.1"
FT                   /translation="MRSLGDMPRIVIISEALGMILLVVAYLSINDYLSLPRAIGTPTVA
FT                   IIMIFVGIGLMIPAAACIVWRVARGFGPLLGSADRISRPQSKKELDKARAEKENKSK"
FT   CDS             376740..377225
FT                   /transl_table=11
FT                   /locus_tag="Y11_03631"
FT                   /product="putative sensory transduction regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27818"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK8"
FT                   /protein_id="CBY27818.1"
FT                   /translation="MDSLIVPDLALLRRWLDQLGISFFECDSCQALHLPHMQNFEGVFD
FT                   AKIDLVDNVILFSALAEVRPTALIPLVADLSQINASSLTVKAFIDIQDDNLPKLIVCQS
FT                   LTVEVGVTFAQFGYFMQQCEEQISMIILEARANDLLFIGNSDDDELPQTATAYPVIH"
FT   CDS             377671..378780
FT                   /transl_table=11
FT                   /locus_tag="Y11_03641"
FT                   /product="putrescine ABC transporter putrescine-binding
FT                   protein PotF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27817"
FT                   /db_xref="GOA:E7BAK7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK7"
FT                   /protein_id="CBY27817.1"
FT                   /translation="MFTQRKKWLSGVAAGLLMAASVSASAEEKTLHIYNWSDYIAPDTL
FT                   ANFQKETGIKVVYDVFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLSAGVFKPLDKSK
FT                   LPNDKNLDPELLTLVSKHDPDNKYAIPYLWATTGIGYNVEKVKAALGKDAPVNSWDLVL
FT                   KPENLEKLKSCGVSFLDAPSEIFATVLNYLGKDPNSIQATDYTGPATELLLKLRPNIRY
FT                   FHSSQYINDLANGDICVAVGWAGDIMQASNRAKEAKNGVNVAYSIPKEGALAFFDVFAM
FT                   PADAKNQDEAYQFLNYLMRPDVIANISNHVFYANANKAATPLVNAEVRDNPGIYPPADV
FT                   RAKMFTLKVQDPKIDRVITRAWTKVKSGK"
FT   CDS             complement(378852..378971)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27816"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK6"
FT                   /protein_id="CBY27816.1"
FT                   /translation="MGGELHHSLSVLSVKAEQAAFEVRRNKKQEQEDNPLFLP"
FT   CDS             379001..380080
FT                   /transl_table=11
FT                   /locus_tag="Y11_03661"
FT                   /product="putrescine transport ATP-binding protein PotG"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27815"
FT                   /db_xref="GOA:E7BAK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK5"
FT                   /protein_id="CBY27815.1"
FT                   /translation="MLEIRNLTKSFDGQAAVDDVNLTIYKGEIFALLGASGCGKSTLLR
FT                   MLAGFEQPTQGQIVLDGQDLSHVPPYQRPINMMFQSYALFPHMTVEQNIAFGLKQDKLP
FT                   ANEIKSRVAEMLTLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALD
FT                   KKLRDRMQLEVVDILERVGATCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEH
FT                   PNSRFSAEFIGSVNVFEGVLKERLDDALVIDSPGLRHPLKVDSDASVVDGVPVFVALRP
FT                   EKVMLCEQVPEDGCNFAVGEVVHIAYLGDLSIYHVKLHSGQMLTAQLQNGHRYRKGMPT
FT                   WGDEVQLCWDADSCVVLGN"
FT   CDS             380102..381067
FT                   /transl_table=11
FT                   /locus_tag="Y11_03671"
FT                   /product="putrescine transport system permease protein
FT                   PotH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27814"
FT                   /db_xref="GOA:E7BAK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK4"
FT                   /protein_id="CBY27814.1"
FT                   /translation="MIPESTHGAAEPPTRAVGPVKALIQRFQMSHGRKLVIGIPYLWLF
FT                   LLFMLPFLIVFKISLAEMARAVPPYTDLVTWLDSKLDISLNLGNYLQLLDDPLYIDAYL
FT                   QSLQVAAVSTLCCLIIGYPLAWAIAHSKSSTRNILLLLVILPSWTSFLIRVYAWMGILK
FT                   NNGILNNFLIWAGIIDQPLIILHTNLAVYIGVVYSYLPFMVLPIYTALTRLDYSLVEAA
FT                   LDLGAKPFKTFVSVIVPLTKGGIVAGSMLVFIPAVGEFVIPELLGGPDSIMIGRILWQE
FT                   FFNNRDWPVASAVATVMLVLLIVPIIWFHKHQNKEPGGAV"
FT   CDS             381064..381909
FT                   /transl_table=11
FT                   /locus_tag="Y11_03681"
FT                   /product="putrescine transport system permease protein
FT                   PotI"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27813"
FT                   /db_xref="GOA:E7BAK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK3"
FT                   /protein_id="CBY27813.1"
FT                   /translation="MNNLPEVRSVWRRVILIVGYTFLYAPMLMLVIYSFNSSKLVTVWA
FT                   GWSIRWYIELFNDSAMISAVGLSLTIAAASATMAVVLGTIAAVVMVRFGRFRGSTGFAF
FT                   MLTAPLVMPDVITGLSLLLLFVAMGHAIGWPAERGMFTIWLAHVTFCTAYVTVVISSRL
FT                   RELDRSIEEAAMDLGATPLKVFFVITVPMIAPALISGWLLAFTLSLDDLVIASFVAGPG
FT                   ATTLPMLVFSSVRMGVNPEINALATLILLVVGIIGLIAWWFMSRSEKQRLRELRKSARG
FT                   "
FT   CDS             complement(381952..382092)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27812"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK2"
FT                   /protein_id="CBY27812.1"
FT                   /translation="MKTLRVKITVSYCPVCLPVRFLQPDVIPDNNAARKRRYKLMKDYQ
FT                   F"
FT   CDS             382059..382535
FT                   /transl_table=11
FT                   /locus_tag="Y11_03701"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27811"
FT                   /db_xref="InterPro:IPR019703"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK1"
FT                   /protein_id="CBY27811.1"
FT                   /translation="MRLLFSPAAFSSATTTPVPVLIAGTAIIATRFVGVILLVATLGWE
FT                   GTGSFIYESLQSWDSGLIFIASILILLLEMVCGVAVCLRQNWVRWCYVACQLLVVVYLL
FT                   MASLDWLVLDVDVFRIEGDTGAEILHSLLLQKIPDVVILGLLFFPWHRYFRSSK"
FT   CDS             382624..383751
FT                   /transl_table=11
FT                   /locus_tag="Y11_03711"
FT                   /product="23s rRNA (Uracil-5-)-methyltransferase rumB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27810"
FT                   /db_xref="GOA:E7BAK0"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011825"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAK0"
FT                   /protein_id="CBY27810.1"
FT                   /translation="MQCAQYTAGRCRSCQWLDKPYPQQLADKQNHLENLLSDHRVTQWL
FT                   SPVFGQESAFRNKAKMVVSGSVERPLLGMLHRDGTPVDLCECPLYPASFAPVFAVLKTF
FT                   IARAGLTPYNVARKRGELKFLLLTESTYSGELMLRFVLRSQTKLAQLQAALPWLQQQLP
FT                   QLAVISVNIQPVHMAILEGEQEIPLTEQQALSEIFNQVPLFIRPQSFFQTNPQVAASLY
FT                   ATARQWVRELKIDSMWDLFCGVGVFGLHCADTETRLTGIEISAEAIACARQSADQLGLK
FT                   NVTFAALDSTQFATAETQVPQLVLVNPPRRGIGAQLCEYLSQMAPQFILYSSCNAETMA
FT                   KDISLLTDYRIERVQLFDMFPHTAHYEVLTLLIKR"
FT   CDS             complement(383871..384620)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03721"
FT                   /product="arginine ABC transporter, periplasmic
FT                   arginine-binding protein ArtJ"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27809"
FT                   /db_xref="GOA:E7BAJ9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ9"
FT                   /protein_id="CBY27809.1"
FT                   /translation="MKKLLLAAILSGMVFSATAAETTHSTETIRFAASATYPPFESIGA
FT                   NNEIVGFDMDLAKALCKQMEANCTFTNQAFDSLIPALKFKRYDAVISGMDITPERSKQV
FT                   AFSQPYYANSAIVIAPKGKFSSFADLKGKKIGMENGTTHQKYLQDKHPEIQTVAYDSYQ
FT                   NAIIDLKNGRIDGVFGDTAVVNEWLKTNPNLAAVGEHVTDPQYFGTGLGIAVRPDNTAL
FT                   LEKLNKAIDAVKADGTYKAINDKWFPQ"
FT   CDS             complement(384946..385071)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27808"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ8"
FT                   /protein_id="CBY27808.1"
FT                   /translation="MDSLTHHFAGSSARVTQAVYPQGNISRKPQVQEGRLALPLG"
FT   CDS             complement(385305..385973)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03741"
FT                   /product="arginine ABC transporter, permease protein ArtM"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27807"
FT                   /db_xref="GOA:E7BAJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ7"
FT                   /protein_id="CBY27807.1"
FT                   /translation="MLEYLPEILKGLHTSLTLTIASLLVALVLSLLFTIVLTLKTPIAT
FT                   PLVKIYITLFTGTPLLVQIFLIYYGPGQFPAIREYPWLWNLLSQPWLCAMIALALNSAA
FT                   YTTQLFYGAVRAIPAGQWQSCEALGMSKAQSLRILLPFAFKRALSSYSNEVVLVFKSTS
FT                   LAYTITLMEVMGYSQLMYGRTYDVMVFGAAGLVYLVVNGLLTLFMRVVERRALAFERRN
FT                   "
FT   CDS             complement(385973..386689)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03751"
FT                   /product="arginine ABC transporter, permease protein ArtQ"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27806"
FT                   /db_xref="GOA:E7BAJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ6"
FT                   /protein_id="CBY27806.1"
FT                   /translation="MNEFQPLASAAGMTVGLAVCALALGLVLAMLFAVCESSRWKIVSY
FT                   LTTGWVTILRGLPEILVVLFIYFGSSQLLMMLSDGFTLNLYLFELPIKLNIDDFEVSPF
FT                   LCGVIALALLYSAYASQTLRGALKAVPVGQWESGQALGLSQVAIFFRLIMPQMWRHALP
FT                   GLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYVIAAAIYLVVTLLSQYV
FT                   LKWIELRTTRFERSPS"
FT   CDS             complement(386701..387432)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03761"
FT                   /product="arginine ABC transporter, periplasmic
FT                   arginine-binding protein ArtI"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27805"
FT                   /db_xref="GOA:E7BAJ5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ5"
FT                   /protein_id="CBY27805.1"
FT                   /translation="MKKLIIAAVLASISLSASAAETIRFAAEATYPPFEFIDANNKMQG
FT                   FDIDLANALCKEMQAECTFTNQAFDSLIPSLKFKRFDAVISGMDITPERQKQVAFTQPY
FT                   YENSALFIAEKGKVADLAALKGKRVGMQNGSTHQKYLMEKHPEITAVPYDSYQNAILDL
FT                   KNGRLDAVFGDTAVVNEWLKQNNQLAAVGDKVTDANYFGTGLGIAVRQNNTELQGKLDA
FT                   ALAKVKADGTYQTIYKKWFQQ"
FT   CDS             complement(387453..388232)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03771"
FT                   /product="arginine ABC transporter, ATP-binding protein
FT                   ArtP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27804"
FT                   /db_xref="GOA:E7BAJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ4"
FT                   /protein_id="CBY27804.1"
FT                   /translation="MPRKLPFTASLAIQIWRMSIQLNGINCYYGVHQALFDITLDCPAG
FT                   ETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLQIAGNHFDFSQAPGAKAIRELRQNVGMV
FT                   FQQYNLWPHLSVIQNLIEAPCRVLGLSKDEAMARAEKLLTRLRLTDFADRFPLHLSGGQ
FT                   QQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAGTGITQVIVTHEVEVAR
FT                   KTASRVVYMENGHVVEQGDASHFTQPTTEAFASYLSH"
FT   CDS             complement(388605..389180)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03781"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27803"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ3"
FT                   /protein_id="CBY27803.1"
FT                   /translation="MKKKNIALILPLAILLSACSNTVDPAYKDIGNRTAPCIDGGPDTV
FT                   AQKFYDLRIQQVGNKSGLPDDNLSAQFRPYLSQALYEQIQTARKQTGNRTSSGVNSTQT
FT                   INGDIFTSLREGSTSADVASASTIPNTDARNIPLRVNLTHQSAGGQSVMWQDEVLMIRE
FT                   GTCWVVDDIRFMGVSAPAGSLRQLLGDR"
FT   CDS             complement(389249..390259)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03791"
FT                   /product="putative nucleotide di-P-sugar epimerase or
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27802"
FT                   /db_xref="GOA:E7BAJ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ2"
FT                   /protein_id="CBY27802.1"
FT                   /translation="MKVLVTGATCGLGRNAVEYLRRQGIKVIATGNNPAMGALLSKMGA
FT                   EFIHADLTNLVSSQAKAMLADVDTLWHCSSFTSPWGTEQAFELANVRATRRLGEWAAAY
FT                   GVENFIHISSPAIYFDYHHHRNIQEDFRPARFANEFARSKAAGEEVIQQLALSNPQTHF
FT                   TILRPQGLFGQHDTVMLPRLLQMIKYYGTLLLPRGGDALVDMTYQENAVHAMWLATQSQ
FT                   NTPSGRVYNITNQQPRPLRTIVQHLLEELDMPCRIRSVPYPMLDIMARAMEKLGNKAEK
FT                   EPILTHYGVAKLNFDLTLDTHRAELELGYRPQVSLDEGIIRTARWLKEHGKLNTG"
FT   CDS             complement(390391..391848)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27801"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ1"
FT                   /protein_id="CBY27801.1"
FT                   /translation="MTPQRVLVLGASGYIGQHLVPRLSQQGHVVTAAARRIEWLKEQHW
FT                   SGVECRFVDLYQPSTLITALQDIGVVYYLVHSMGDGQDLIEQERLAATNMKTALQQSPS
FT                   VKQIIYLSALQPDDNSSSHLIARKLTGDLLCQSGIPVTELRASIIVGPGSAAFEIMRDM
FT                   VYNLPILTPPRWVRSKSSPVALENLLIYLTELLNHPASENRIFDVAGPEYISYQTMFER
FT                   FIAISGKRRWLVPIPLPTRFISVYFINMVTSVPTSIASALIEGLNHDLPADGQALQALI
FT                   PQQLISFDDAVKETLRREDEVVDSPDWGYDPEARARWRPGYGFYPKQAGCQLYTSASSE
FT                   ALWHVVQQIGGKEGYFYGNPLWKTRAWMDDLAGGGVVYGRPDRETLELGDLIDGWKVIT
FT                   LKPLRQLAMMFGMKAPGLGRLTFTIKDLGGRRSFDVRAWWHPAGFNGLLYWFVMMPAHL
FT                   FIFRGMAKRITTLAVQYDRERNHKSDE"
FT   CDS             complement(391845..392864)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03811"
FT                   /product="low-specificity L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27800"
FT                   /db_xref="GOA:E7BAJ0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAJ0"
FT                   /protein_id="CBY27800.1"
FT                   /translation="MLIDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAA
FT                   KLSGKEAALFLPTGTQANLVALLTHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPI
FT                   DANDDGTLPLDKVLAAIKPDDIHFAQTRLLSLENTHSGKVLPLSYLQQAWALTREQKLA
FT                   LHIDGARVFNAAVALNVPLSEITQYCDTLTICLSKGLGAPVGSLLCGSAEYIKRARRWR
FT                   KMTGGGMRQAGILAAAGLYALEHNVARLKDDHDNALWLEQQLRALGVEIVAPGAQTNVL
FT                   YIKQPAELATKLGSWMREHGVLISAGPITRMITHINISRTDLEKVVALWREFLSEQRS"
FT   CDS             complement(393002..393889)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03821"
FT                   /product="O-methyltransferase involved in polyketide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27799"
FT                   /db_xref="GOA:E7BAI9"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI9"
FT                   /protein_id="CBY27799.1"
FT                   /translation="MAKSTMSDFSPSAELICILRAKSYSEKREGYKTDDYISLLISHSL
FT                   TSFFSMTQKSFLMPGNILSPQIPAGSYEFLISRIKYIDEFFQLRASEFANIFILGPGFD
FT                   SRAIRFQNQLQQSRVFELDHPVSQKNKIAKLQELTIPIPENLRYIPIDFNLQDLTTILQ
FT                   EIPRKKGEKNLFILEGLIMYLPPSTVNRIFSAIDACAPDSSEIIFDYVYSDVLAGENTS
FT                   YGSVEVFEGLKNIGEHWIFGIEKGHLTAFLNKYHLKLYCDADASTLETRFFTNKQGTVL
FT                   GKLNKALAIAHGIK"
FT   CDS             complement(394121..395842)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03831"
FT                   /product="pyruvate oxidase [ubiquinone, cytochrome]"
FT                   /EC_number="1.2.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27798"
FT                   /db_xref="GOA:E7BAI8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI8"
FT                   /protein_id="CBY27798.1"
FT                   /translation="MKQTVATLVAKTLEQAGVKRIWGVTGDSLNGLSDSLHRMGTIEWL
FT                   GTRHEEVAAFAAGAEAQLTGQLAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPS
FT                   SEIGSGYFQETHPQELFRECSHYCELVSNPEQLPRVLEIAMRKAILNRGVSVIVLPGDV
FT                   ALQPAPEDAAVVWQTPKLPLVQPLMSELIILAETLNQAKNITLMCGSGCADAHDEVVKL
FT                   AEMLQAPVVHALRGKEHIEWGNPYSVGMTGLIGFASGYHAMMNADTLVLLGTQFPYRAF
FT                   YPTHANIIQIDINPGSIGAHCPVNMALVGDIKTTLSALLPQLEAKSDNTFLTKALEHYR
FT                   TTRKDLDGLATANDNQPIHPQYLAQQISRHATDDAVFTCDVGTPTVWAARYLEMNGKRR
FT                   LLGSFNHGSMANAMPQAIGAQATDPNRQVVALCGDGGFTMLMGDFLTLAQLKLPVKIVV
FT                   FNNSVLGFVAMEMKAGGYLTDGTDLHNPDFAAIANAAGIKGIRVEKASELDAALESAFA
FT                   HPGPVLVDVVTAKQELSMPPQIKFEQAKGFSLYMLRAIINGRGDEVVELAKTNWLR"
FT   CDS             complement(395942..397048)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03841"
FT                   /product="NADH oxidoreductase hcr"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27797"
FT                   /db_xref="GOA:E7BAI7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI7"
FT                   /protein_id="CBY27797.1"
FT                   /translation="MPGQCALLSLAGHKSFFAPNDLICCEVHMTDFIPTDCPTAITPNR
FT                   MQVHSIVQETPDVWSLGLINHDFYPYLPGQYALVSIRNSDETLRAYTLSSTPGLSPFIQ
FT                   LTVRCLADGEGSQWLTQQVKEGDYLWLSDAQGEFSCAHFDDDHYLMLAAGCGVTPVMSM
FT                   CRYLLAQRPKADIRVIFNVRTPADVIFADAWQALLQQYPQQLQLTLMAESDATDGFIAG
FT                   RINAQVMQQVAPDITHRRVMTCGPAPYMDWVEQYCREQAVPNDHFQKEQFRTSDEVIDS
FT                   SNELTMTISHPLRSVKVPVGTSLLFALEQHKVPVMAACRAGVCGSCKTRILHGDYTTSS
FT                   TMTLTPEEIAQGYVLACSCQLQGDVQLA"
FT   CDS             complement(397063..398715)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03851"
FT                   /product="hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27796"
FT                   /db_xref="GOA:E7BAI6"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI6"
FT                   /protein_id="CBY27796.1"
FT                   /translation="MFCVQCEQTIRTPVGNGCSYAQGMCGKTAETSDLQDLLVAVLQGL
FT                   SAWVLTARELGIVDHEIDSFAPRAFFSTLTNVNFDSDRIVGYAKEAILLRQSLAIRCRL
FT                   IDSTITVDHPLAELQLHSDDIPTLQQQAQQFALNTDKAEVGDDIHGLRMLCLYGLKGAA
FT                   AYMEHAHVLGQSDEQIYADYHAYMAWLGTQPRDVDTLLNNAMGIGKMNFNVMAILDRGE
FT                   TQAYGDPQPTSVNVRPVAGKAILISGHDLKDLQMLLEQTQGTGINIYTHGEMLPAHGYP
FT                   ELKRYSHLVGNYGSGWQNQQTEFAKFPGPILMTSNCIIDPNVGNYGDRIWTRSIVGWPG
FT                   VNHLEGEDFTPVIEQALGMAGFPYNELEHLITVGFGRQTLLNAADTVIDLVATKKLRHV
FT                   FLVGGCDGSRTERSYFTDFARSVPQDCIIMTLACGKYRFNKLDFGTLEGLPRLLDVGQC
FT                   NDAYSAIMLAVKLSEKLGCTVNDLPLSLVLSWFEQKAIVILLTLLSLGVKNIYTGPTAP
FT                   GFLTDNLMAILYEKFGMRPITTVEQDMNAILGH"
FT   CDS             complement(398912..399811)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03861"
FT                   /product="putative surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27795"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI5"
FT                   /protein_id="CBY27795.1"
FT                   /translation="MYSGLLIILLPLILGYLIPLSRKTFIQLINRLLSWMVYVILFFMG
FT                   ISLAFLENLSANLLLIFQYTGVFFLCIFCANLLALFLLERKTPWKNTHRQEALPSRLHM
FT                   ALESLKLCGVVIIGFLLGLSQWEWLQFAAKGSELALIFLLFLVGIQLRNSGMTLRQIVL
FT                   NRRGTIVAFVVAISALAGGMLAAVLMDLPIKTGLAMASGFGWYSLSGILLTDSFGPVIG
FT                   SAAFFNDLARELVAIMLIPTLVRSSRSTALGLCGATSMDFTLPVLQHSGGLEMVPAAIV
FT                   HGFILSLLAPILIAFFSS"
FT   CDS             400062..401726
FT                   /transl_table=11
FT                   /locus_tag="Y11_03871"
FT                   /product="putative ATP-dependent endonuclease of the OLD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27794"
FT                   /db_xref="GOA:E7BAI4"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI4"
FT                   /protein_id="CBY27794.1"
FT                   /translation="MYLERVDIVGFRGINRISLNLDDNTVLIGENAWGKSSLLDALTLL
FT                   LSPEPQLYHFTSQDFYYPAGDESAKERHLQIIFTFCEKDIGHWRAPRYRQLAPLWIKND
FT                   DGLHRIYYRIEGESADDGTVCTWRTFLDLDGAALELHDIEKLARGVIRIHPVLRLRDAR
FT                   FIRRLRSTTTENSNQPDKVALNQQLDQLSRELVRNPQKLTNTQLRQGLEAMRQLLEHYF
FT                   AEQGAQSANLRNHRHRPQPEREAWLALDSINRMVAEPNSRSMRLILLGMFSTLLQAQGS
FT                   LSLDPHARPLLLVEDPETRLHPIMLSVAWGLLSQLPLQRITTTNSGELISLVPVESICR
FT                   LVRESSRVATYRIGPRGMSSEDSRRIAFHIRFNRPSALFARCWLLVEGETEIWLLNELA
FT                   RQCGYHFEAEGVKVIEFAQSGLRPLLKFANRMGIQWHVLTDGDDAGKKYAATVRNMADN
FT                   ERDHERDRLTILPAPDMEHFLYRSGFDEVYHRISGIPANAKMQPRRVIEKAIHRTSKPD
FT                   LAIEVTSYARERGIEFIPPLLKKMFSRVVWLARGRAD"
FT   CDS             complement(401723..402706)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03881"
FT                   /product="virulence factor VirK"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27793"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI3"
FT                   /protein_id="CBY27793.1"
FT                   /translation="MLINNNPVLIPNNINRWRLITLLFKGHQALGGSWQKSQFRLKFIA
FT                   RTLISPKLTFNLLGVLVKQPFLNSMLRAQPDLPCKLHRPYLANTLNNRQKLEVLQAHFQ
FT                   LVNQCIPELLRRNYLHHSPYKLTELTGKNEEKYSIYLGVIPKLNKEGEITLMLANEQQQ
FT                   TLALLTFSLTYYQNQKTLFIGGLQGADNETPHSEIHACTKACHGLFPKRLVLEATCCLA
FT                   ELMGITQIIAVGNATHVYQNWRYRAKKRDKLHADYDNFWLSLGGKQCSEGHFNLPARIA
FT                   RKPIEDIASKKRAEYRRRYQLLAQLENGLAAHFSPDQGCSGGAIPR"
FT   CDS             402898..404010
FT                   /transl_table=11
FT                   /locus_tag="Y11_03891"
FT                   /product="macrolide-specific efflux protein MacA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27792"
FT                   /db_xref="GOA:E7BAI2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI2"
FT                   /protein_id="CBY27792.1"
FT                   /translation="MQFSSSQRRWLIAIAVLIIGGFFIIRHLMAPTPVQFQTVKVANRD
FT                   LQQNVLATGKLDAVRKVDVGAQVSGQLEKLYVEIGDQVKQGQLLAMIDPQQAQNQIKEV
FT                   EATLQDLNAQLGQAKAELQLAAVTLRRQQDLAKLQAVSRQDLDQASTALAVKKAQVETI
FT                   NAQINKTKASLDTANINLDYTKISAPMDGDVVQITTLQGQTVIAAQQAPNILTLADMST
FT                   MLVNAQVSEADVIHLKPGMKASFTVLGDPEKRFDGVLKDIQPTPEKVNDAIFYSARFEV
FT                   PNPDRLLRLQMTAQVSIQLANVPQAMVIPLSALGDELGTNRYQVAVLKDGKEEKREVTI
FT                   GIRNNVDAQVISGLNVGDEIIVSRGGTEEA"
FT   CDS             404010..405959
FT                   /transl_table=11
FT                   /locus_tag="Y11_03901"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27791"
FT                   /db_xref="GOA:E7BAI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI1"
FT                   /protein_id="CBY27791.1"
FT                   /translation="MAALLELKGIRRSYQSGEETVDVLQDVSLTINAGELVAIIGASGS
FT                   GKSTLMNILGCLDKPSSGVYRVAGQDVAALDNDALAALRREHFGFIFQRYHLLPHLSAA
FT                   HNVEVPAVYAGLGKNERRERANMLLTRLGLGERVSYQPNQLSGGQQQRVSIARALMNGG
FT                   QVILADEPTGALDSHSSVEVMAILKQLQQQGHTVIIVTHDPTVAAQAERVIEIKDGRIM
FT                   ADSGSKITQEAVSSDAISLTPPAPSWQQLAGRFREALLMAWRAMSANKMRTALTMLGII
FT                   IGIASVVSILVVGDAAKQLVLADIRAIGTNTIDIYPGKDFGDDDPSTRQALVYDDMTAL
FT                   KAQSYVSAVSPTIAGSMRLRYGNIDVAASVSGVSDQYFRVYGMKLEQGTAITREQVERQ
FT                   SQVVVIDRNTQRRLFPHIKDVVGQVILIGNMPATVVGVVEEKQSMFGSSKALRVWVPYS
FT                   TMASRLMGRSYFDSITIRIKEGYSSKEAEQQLVRLLTMRHGKKDIFTYNMDSLLQTAEK
FT                   TTRTMQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARSSDVMQQFLIE
FT                   AILVCLVGGALGISLSFAIGLIVEMFLPNWQIAFPPVALFSAFLCSTVIGVVFGYLPAR
FT                   SAARLNPIDALARE"
FT   CDS             complement(406158..406415)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03911"
FT                   /product="cold shock protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27790"
FT                   /db_xref="GOA:E7BAI0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR012751"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAI0"
FT                   /protein_id="CBY27790.1"
FT                   /translation="METGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAG
FT                   QMVNFAVHQGPKGNHASLIVPLGLDVVLQEAIPQEHAALA"
FT   CDS             406748..407095
FT                   /transl_table=11
FT                   /locus_tag="Y11_03921"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27789"
FT                   /db_xref="GOA:E7BAH9"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH9"
FT                   /protein_id="CBY27789.1"
FT                   /translation="MVQRNDGQAMGKNNDWLNFEHLVKDKQIEALKPPSMYKVILNNDD
FT                   YTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVNQYAREN
FT                   EHPLLCTLEKA"
FT   CDS             407121..409397
FT                   /transl_table=11
FT                   /locus_tag="Y11_03931"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27788"
FT                   /db_xref="GOA:E7BAH8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH8"
FT                   /protein_id="CBY27788.1"
FT                   /translation="MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPAAREALE
FT                   ACSVDLVALRQELEAFIEQTTPTLPVSEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVS
FT                   GANVLVAIFSEQESQAAYLLRKHDVSRLDVVNFISHGARKDEPGQAPNAENPVNEEQAG
FT                   GEDRMENFTTNLNQLARVGGIDPLIGRDKELERTIQVLCRRRKNNPLLVGESGVGKTAI
FT                   AEGLAWRIVQGDVPEVMSECTLYSLDIGSLLAGTKYRGDFEKRFKALLKQLENDKDSIL
FT                   FIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRF
FT                   QKIDITEPTPEETVQIINGLKPKYEAHHDVRYTAKAIRAAVELSVKYINDRHLPDKAID
FT                   VIDEAGARSRLMPVNKRKKTVNVSDIESVVARIARIPEKTVSASDRDVLKNLSDRLNML
FT                   VFGQDKAIEALSEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLAKALDIELLR
FT                   FDMSEYMERHTVSRLIGAPPGYVGYDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNLL
FT                   LQVMDNGTLTDNNGRKADFRNVILVMTTNAGVRETQRTSIGFKQQDNSTDALEEIKKVF
FT                   TPEFRNRLDNIIWFNHLSPAVIQQVVDKFIVELQAQLDAKGVSLEVSEEARDWLSDKGY
FT                   DKAMGARPMARVIQENLKKPLANELLFGSLVDGGSVTVGLDKEKQQLAYEFQSAQKRKT
FT                   EGAVH"
FT   CDS             complement(409642..409860)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03941"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27787"
FT                   /db_xref="GOA:E7BAH7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH7"
FT                   /protein_id="CBY27787.1"
FT                   /translation="MAKEDNIEMQGTVLDTLPNTMFRVELENGHVVTAHISGKMRKNYI
FT                   RILTGDKVTVELTPYDLSKGRIVFRSR"
FT   CDS             complement(410026..410736)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03951"
FT                   /product="leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /EC_number="2.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27786"
FT                   /db_xref="GOA:E7BAH6"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH6"
FT                   /protein_id="CBY27786.1"
FT                   /translation="MRITQLSSQSFAFPSPELALREPNGLLALGGDLSPPRLLAAYERG
FT                   IFPWFSPGEMILWWSPDPRAVLYPEDLHISRSMRRFLRNCPYRFTLNHAFEDVVRACAT
FT                   LRDEGTWIGDDVQQAYCHLHTLGHAHSVEVWLENELVGGLYGISVGSLFCGESMFSRAN
FT                   NASKSALMVFCHHFTHHGGELIDCQVLNAHTASLGAIEIPRNFFLQQLSQLQFSPLPAE
FT                   CWLPQSLNFSSTMQ"
FT   CDS             complement(410970..412694)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03961"
FT                   /product="transport ATP-binding protein CydC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27785"
FT                   /db_xref="GOA:E7BAH5"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH5"
FT                   /protein_id="CBY27785.1"
FT                   /translation="MRVLLPFLALYRRHWFLICLGIVLAIITLLASIGLLTLSGWFLAG
FT                   TAIAGPAGLYTFNYLLPAAGVRGAAITRTAGRYAERVVSHDATFRVLAHLRVFAFQKIL
FT                   PLSPAGIARFRQSELLNRLVADVDTLDHLYLRVISPLVAAVVIIAAVAFGLSYIDVNLA
FT                   LTLGAILLGLLLLVPLIFYRAGKPIGHDLTDLRGLYRSQLTSWLQGQAELLVFGALHRF
FT                   RTSLEEIEQRWMIRQKQQASLAGLAQALMILASGLTVTLILWLAAAGIGGDSQPGALLA
FT                   LFVFTSLAAFEALLPVAGAFQHLGQVIASATRVGQLIEQKPEVTFPDSGPAAVPQVELE
FT                   VTGLSFTYPQQPLPVLQNISLSLASGEHIALLGRTGCGKSTLLQLLTRAWDANEGVITL
FT                   NGKPLASFDETTLRQMMTVVNQRVHIFSSTLRENLLLACPTATDEQLKIVLAQVGLANL
FT                   LDNDEGLNAWMGDGGRPLSGGEQRRLGIARALLHPAPLLLLDEPTEGLDAETEQQILTL
FT                   LRQHCQHKSLIIVTHRLYGLEYMDRICVMDGGKIVEQGSHQNLLQNKGRYYQFHQRH"
FT   CDS             complement(412697..414463)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03971"
FT                   /product="transport ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27784"
FT                   /db_xref="GOA:E7BAH4"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH4"
FT                   /protein_id="CBY27784.1"
FT                   /translation="MNKTRQYELIRWLKKQSAPAQRWLRLSMLLGLLSGLLIIAQAWLL
FT                   ATLLQSLIIDKVPRTELITDFGLLAGTFAIRAVISWLRERVGFVCGMKVRQQIRKTVLD
FT                   RLEQLGPAWVKGKPAGSWATIILEQIEDMQDYYSRYLPQMYLAVLIPVLILIAVFPINW
FT                   AAGLILFVTAPLIPLFMALVGMGAADANRRNFVALARLSGNFLDRLRGLDTLRLFNRAK
FT                   AETDQIRESSEDFRRRTMEVLRMAFLSSAVLEFFAAISIAVVAVYFGFSYLGELNFGSY
FT                   GLGVTLFAGFLVLILAPEFFQPLRDLGTFYHAKAQAVGAAESLVTFLSTDGETIGRGDK
FT                   VLDGTDSITLEANELEILSPTGTRLAGPLTFSLSAGKRVAIVGLSGAGKSSLLNLLLGF
FT                   LPYRGSLKVNNIELRELDPQTWRHQLSWVGQNPHLPEQTLVANILLGQPDANNDQLQLA
FT                   IERAYINEFLNDLPQGLDTEVGDHSARLSVGQAQRIAVARALLNPCRLLLLDEPTASLD
FT                   AHSEQLVMKALEEASRKQTTLLVTHQLEDTLGYDQIWVMDNGLLIQHGDYSSLSQADGS
FT                   FANLLSHRSEEL"
FT   CDS             complement(414738..415700)
FT                   /transl_table=11
FT                   /locus_tag="Y11_03981"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27783"
FT                   /db_xref="GOA:E7BAH3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH3"
FT                   /protein_id="CBY27783.1"
FT                   /translation="MSTAKHSKLIILGSGPAGYTAAVYAARANLNPVLITGMEKGGQLT
FT                   TTTDVENWPGDPEGLTGPALMERMHAHAEKFQTEILFDHIHKVDLQNRPFRLFGDSAEY
FT                   TCDALIIATGASARYLGMESEEAFKGKGVSACATCDGFFYRNQKVAVVGGGNTAVEEAL
FT                   YLANIAAEVHLIHRRDSFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVR
FT                   LKSTKNNETEELAVAGVFIAIGHSPNTAIFGGQLALENGYIKVQSGIQGNATQTSIPGV
FT                   FAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLVNDK"
FT   CDS             416470..416964
FT                   /transl_table=11
FT                   /locus_tag="Y11_03991"
FT                   /product="leucine-responsive regulatory protein, regulator
FT                   for leucine (or lrp) regulon and high-affinity
FT                   branched-chain amino acid transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_03991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27782"
FT                   /db_xref="GOA:E7BAH2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH2"
FT                   /protein_id="CBY27782.1"
FT                   /translation="MTDNKKRPGKELDRIDRNILNELQKDGRISNVELSKRVGLSPTPC
FT                   LERVRRLERQGFINGYTALLNPQYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLDEIQ
FT                   ECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQTSHLVIKT
FT                   R"
FT   CDS             417086..420700
FT                   /transl_table=11
FT                   /locus_tag="Y11_04001"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27781"
FT                   /db_xref="GOA:E7BAH1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH1"
FT                   /protein_id="CBY27781.1"
FT                   /translation="MSQEYTEDKEVTLKKLSSGRRLLEAVLIVVTILAAFLMAALLSFN
FT                   PSDPSWSQTSWHEPIHNLGGSVGAWMADTLFFTFGVLAYAIPAIMVMLCWAAFRQRDAS
FT                   EHIDYFALSLRLIGTLALILTSCGLAALNIDDLYYFASGGVIGSLFSNAMLPWFNGVGA
FT                   TLTLLCIWAVGLTLFTGWSWLVIAEKIGGVVLGSLTFMTNRSRREERYDNEDDDYQIEE
FT                   ANTTEQDKGVGANNKAVAGVAAASALVANSVHADDDDVLFSAPSVTDTPAHPILDGAIP
FT                   TDEIVAESGEPLNNYDPLLSTLRATDNGEQPGLASVGNPSEPIINHSAVSMVDNVATTP
FT                   PLYSFEIPQEATSPAPTRIAPPIERPEPQLGSWDKPATPTSHSPFDFSAAQRHSDQVEN
FT                   TPYMNPGLGTDTDSLAAMGSVSRSGSASAAGIVAASTAAATFMPAFTATSDSSSQVKQG
FT                   IGPELPRPNPVRIPTRRELASYGIKLPSQRMAEQEQRAQEVQTPQMPETPFTAGAISED
FT                   DDALEQAILRKAFADQQSERYGQSADTGVNTFSAVEPEDEQALQEAALRQAFAAQQQHR
FT                   YGATQGENSDNSQYEHAVVEEMQPVDTRSAFTFSPVADLVDESPREPLFTLSPYVDEAA
FT                   QPTPVQSSSASEHTEQVSAYQPPAANQTHQAYSGQSTSVQPTASAQPVSPVQPTPAMDS
FT                   LIHPFLMRNDQPLVKPITPLPTLDLLSSPPAEEEPVDMFALEQTARLVEARLGDYRVKA
FT                   EVVGISPGPVITRFELDLAPGVKASRISNLSRDLARSLSAIAVRVVEVIPGKPYVGLEL
FT                   PNKHRQTVYLREVLDCAKFRDNPSPLAIVLGKDIAGQPVVADLAKMPHLLVAGTTGSGK
FT                   SVGVNAMILSILYKATPDDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWC
FT                   VGEMERRYKLMSALGVRNLAGYNERVAQAEAMGRPIPDPFWKPSDSMDISPPMLVKLPY
FT                   IVVMVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPT
FT                   RIAFTVSSKIDSRTILDQGGAESLLGMGDMLYMAPNSSIPVRVHGAFVRDQEVHAVVND
FT                   WKARGRPQYIESILSGSDEGEGGSLGLDSDEELDPLFDQAVNFVLEKRRASISGVQRQF
FT                   RIGYNRAARIIEQMEAQQIVSTPGHNGNREVLAPPPHE"
FT   CDS             420930..421541
FT                   /transl_table=11
FT                   /locus_tag="Y11_04011"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27780"
FT                   /db_xref="GOA:E7BAH0"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAH0"
FT                   /protein_id="CBY27780.1"
FT                   /translation="MKKLLVACCLLSGLISAHALADASSDLQARLSKVNSFHANFSQKV
FT                   TSSEGTAVQEGEGELWVKRPNLFNWHMTSPDESILISDGETLWFYNPFVEQATATWLKN
FT                   ATGNTPFMLITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITVTPTGTIKSFTA
FT                   VEQDGQRSAYTLKGQQNSSADASKFKFTLPKGVTLDDQRQ"
FT   CDS             421558..422892
FT                   /transl_table=11
FT                   /locus_tag="Y11_04021"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27779"
FT                   /db_xref="GOA:E7BAG9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG9"
FT                   /protein_id="CBY27779.1"
FT                   /translation="MSLDFSQNEFQPLAARMRPLTLEQYIGQQHLLAPGKPLSRAIVAG
FT                   QLHSMILWGPPGTGKTTLAEIIGRYGQADVERISAVTSGIKEIREAIERARQNRDAGRR
FT                   TILFVDEVHRFNKSQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARVYLLKALT
FT                   AADIEKVIEQAMSDSRRGYGGQNIKLPDETRRMMSELVGGDARRALNSLEMMADMAEID
FT                   ANGVRVLTPDLLKEVSGERSARFDNKGDRYYDLISAVHKSIRGSAPDAALYWYARIITA
FT                   GGDPLYVARRLLAIASEDIGNADPRAMQVAISAWDCFTRVGPAEGERAIAQAIVYLACA
FT                   PKSNAVYSAFKAAMQDARDKPDFDVPEHLRNAPTKLMKEMGLGAEYRYAHDEQHAYAAG
FT                   ENYFPPEMASTRYYLPSSRGLEGKIGEKLAWLAEQDQNSPIKRYR"
FT   CDS             423064..424356
FT                   /transl_table=11
FT                   /locus_tag="Y11_04031"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27778"
FT                   /db_xref="GOA:E7BAG8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG8"
FT                   /protein_id="CBY27778.1"
FT                   /translation="MLDPNMLRNELDAVAEKLARRGFKLDVEMLRQQEERRKVLQVETE
FT                   SLQAERNSRSKLIGAAKARGEDIEPLRLEVNELGEKLDAAKAELDKLQNEIRDLALSIP
FT                   NLPDDSVPVGKDENDNLEVSRWGEPRQYDFEVRDHVSLGEMAGGLDFAAAVKLTGARFV
FT                   VMKGQIARMHRALAQFMLDLHTEKHGYLETYVPYLVNHATLYGTGQLPKFGGDLFHTKP
FT                   LEEESDSSNYALIPTAEVPVTNLVRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGL
FT                   IRMHQFDKVEMVQITRPEDSMAALEELTGHAEKVLQLLELPYRKMLLCTGDMGFGSSKT
FT                   YDLEVWLPAQNTYREISSCSNMWDFQARRMQARCRNKTDRKTRLVHTLNGSGLAVGRTL
FT                   VAVLENYQQADGRIQVPEVLRPYMGGLEFIG"
FT   CDS             complement(424799..425848)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04041"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY26446"
FT                   /db_xref="GOA:E7B3P2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B3P2"
FT                   /protein_id="CBY26446.1"
FT                   /translation="MLKLRRRSVHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLTEQELSRWAKTQPACQ
FT                   RVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAWLGLVPREFSSGGKQRLGRISKRGD
FT                   RYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHH
FT                   TEYRTLSVV"
FT   CDS             425933..427126
FT                   /transl_table=11
FT                   /locus_tag="Y11_04051"
FT                   /product="ISsod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27776"
FT                   /db_xref="GOA:E7BAG6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG6"
FT                   /protein_id="CBY27776.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKQLTEAALAAELDS
FT                   HLAQDLEANRKNGSGKKTIKAPTGRFELTTPRDRNGTFEPQLVKKHQTTLSDEIERKII
FT                   RMFALGMSYKDISQEIEDLYAFSVSSATISAVTDKVIPELKQWQQRPLEAVYPFVWLDA
FT                   IHYKIRENGRYQSKAVYTVLALNLEGKKEILGLYLSENEGANFWLSVLTDLQNRGVNDI
FT                   LIACVDGLTGFPEAINSIYPDTEVQLCVIHQIRNSIKYVASKHHKAFMADLKPVYRAVS
FT                   KEAAETALEEKWGQQYPVVLQSWRRKWENLSHYFRYPATIRKVIYTTNAIESVHRQFRK
FT                   LTKTKGAFPNENSLLKLLYLGLMNAQEKWTMPIQSWNLTLSQLAIYFEGRLDKVITL"
FT   CDS             427445..428593
FT                   /transl_table=11
FT                   /locus_tag="Y11_04061"
FT                   /product="hypothetical MFS-type transporter protein ycaD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27775"
FT                   /db_xref="GOA:E7BAG5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023745"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG5"
FT                   /protein_id="CBY27775.1"
FT                   /translation="MSAYSRPVLLLLCGLLLFTISIAVLNTLVPLWLSHQQLPTWQVGM
FT                   VSSSYFSGNLVGTLIAGRIIQQLGFNRSYYYSCILFVLATCGLMLSVDFWNWLGWRFFA
FT                   GVACALIWVIVESALLRSGTVTNRGQLLAAYMMVYYMGTVTGQLLLGVVSTQLLSVIPW
FT                   VSALVITAMLPLLFAHFSHQDSSDVPHIAVWPMLKRRSARLGINGCIISGVLLGSLYGL
FT                   LPLYLSHQGMSDASVGWWMALLVSSGIIGQWPIGKMADRYGRLLVLRIQVFVVILGSIA
FT                   ILGNYALAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTIGSLTGPTM
FT                   TSLLMQRYSDNLLFIMIAGVALVYLMMLLRKPDQQKTPFAAV"
FT   CDS             complement(428671..429411)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04071"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27774"
FT                   /db_xref="GOA:E7BAG4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG4"
FT                   /protein_id="CBY27774.1"
FT                   /translation="MSVLGRIHSFESCGTVDGPGIRFIVFFQGCLMRCLYCHNRDTWDT
FT                   HGGKEVTVEELVKEAVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACHEEGIHTCL
FT                   DTNGFVRRYDPVIDELLDATDLVMLDLKQMDDSVHQNLVGVSNHRTLEFARYLAKRNQK
FT                   TWIRYVVVPGWSDDDKSAHMLGEFTQNMTNIEKIELLPYHELGKHKWIAMGEEYKLDGV
FT                   KPPTTEIMDRVKGILESYGHKVIY"
FT   CDS             complement(429490..431772)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04081"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27773"
FT                   /db_xref="GOA:E7BAG3"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG3"
FT                   /protein_id="CBY27773.1"
FT                   /translation="MTELNEKLAKAWQGFTQGDWQKEVNVRDFIQKNYTPYEGDESFLA
FT                   GSTEATDKLWAQVMEGIKLENRTHAPVDFDTDVAATIISHDAGYINKDLETIVGLQTEK
FT                   PLKRALIPFGGIKMVEGSCKVYGRELDPQLKKVFTEYRKTHNQGVFDVYTKDILNCRKS
FT                   GVLTGLPDAYGRGRIIGDYRRVAVYGIDFLMKDKLAQFNSLQDDLENGKDLEMTIQLRE
FT                   EIAEQHRALGQIKEMAAKYGCDISGPATNAKEAVQWTYFGYLAAVKSQNGAAMSFGRVS
FT                   TFLDVYIERDMKEGKLTEIEAQELIDHLVMKLRMVRFLRTPEYDELFSGDPIWATESLA
FT                   GMGVDGRTLVTKTSFRFLNTLYTMGPSPEPNMTILWSEKLPLNFKKYAAKVSIDTSSVQ
FT                   YENDDLMRPDFNNDDYAIACCVSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKMKIQ
FT                   VGPKEAPMMDEVLDYDKVMERMDHFMDWLAKQYVTALNIIHYMHDKYSYEAALMALHDR
FT                   DVYRTMACGIAGLSVAADSLSAIKYAKVSTIRDADGLAIDFNIEGEYPQFGNNDSRVDD
FT                   IACDLVERFMKKIQKLRTYRGAVATQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGAN
FT                   PMHGRDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDDEVRKANLAGLMDGYF
FT                   HHEASIEGGQHLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVIT
FT                   RTFTQSI"
FT   CDS             complement(431825..432682)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04091"
FT                   /product="formate efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27772"
FT                   /db_xref="GOA:E7BAG2"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023999"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG2"
FT                   /protein_id="CBY27772.1"
FT                   /translation="MKADNPFDALLPAAMAKVAEDAGVYKATKHPLKTFYLAITAGVFI
FT                   SIAFVFYITATTGTAGVPFGFAKLVGGICFSLGLMLVVVCGGDLFTSTVLTTVAKASGR
FT                   ITWRQLGCNWVNVYIGNLCGALFFVCLIWFAGQYTVANGQWGLNVLQTADHKLHHTFVE
FT                   AVCLGILANLMVCLAVWMSYSGRTIMDKMFAMILPVGMFVASGFEHSIANMFMIPMGIV
FT                   IKNFASPEFWQSIGAAPEQFANLTVSNFIIDNLIPVTIGNIIGGGLLVGLTYWVIYLRG
FT                   DQQH"
FT   CDS             432823..432993
FT                   /transl_table=11
FT                   /locus_tag="Y11_04101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27771"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG1"
FT                   /protein_id="CBY27771.1"
FT                   /translation="MIFKIKNILRFIKIFDYTVLKPLRTLTKSSIRSYFNLPSSLKINY
FT                   LFTYLSAFQDW"
FT   CDS             complement(433118..433252)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27770"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAG0"
FT                   /protein_id="CBY27770.1"
FT                   /translation="MARVEPPGMGLRRLYDLLVLSVAGTLSKVSSGISPLFYRKFFGY"
FT   CDS             complement(433528..433938)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04121"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27769"
FT                   /db_xref="GOA:E7AZF6"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7AZF6"
FT                   /protein_id="CBY27769.1"
FT                   /translation="MGKTQPACQRVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAWL
FT                   GLVPREFSSGGKQRLGRISKRGDRYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKA
FT                   YNVAVVAQANKTARILWSMLVHHTEYRTLSAV"
FT   CDS             complement(433942..434577)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04131"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY26093"
FT                   /db_xref="GOA:E7B1Q7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E7B1Q7"
FT                   /protein_id="CBY26093.1"
FT                   /translation="MLKLRRRSIHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGCGRSNHVDRTRT"
FT   CDS             complement(434781..436547)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27767"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF7"
FT                   /protein_id="CBY27767.1"
FT                   /translation="MTQTFIPGKDAALEDSISRFQQKLSDLGFNIEEASWLNPVPHVWS
FT                   VHIRDRDCPLCFTNGKGASKKAALASALGEYFERLSTNYFFADFYLGKAIAEGDFVHYP
FT                   NEKWFSIPEDDLLPEGILDERLLAFYDPENELVASDLVDLQSGNAARGICSLPFTRQSD
FT                   LETVYIPMNIIGNLYVSNGMSAGNTANEARVQALSEVFERSVKNRIIAESISLPEIPAE
FT                   VLNRYPGVVEAIAKLEEEGFPILSYDASLGGKYPVICVVLFNPSNGTCFASFGAHPDFG
FT                   VALERTVTELLQGRSLKDLDVFTAPTFDDEEVAEHTNLETHFIDSSGLISWDMFKQQAD
FT                   YPFVDWSFKGTTEEEFATLMAIFKQEDAEVYIADYEHLGVYACRILVPGMSDIYPAEDL
FT                   LMANNTMGVHLRDTLLALPDSDWQPEQYLELIQTLDDEGLDDFARVRELLGIASGKDNG
FT                   WYTLRVGELKSMLALAGGDLDQALIWVEWTQDFNSSVFTAKQANYYRCLQTLLLLTQEP
FT                   DRDPAQYYNAFVKMYGQEAVEAASAAIAGEERFNGLFSVDEDLKALPAHQALLGAYAKL
FT                   QAAKRRYWAKSE"
FT   CDS             436696..437064
FT                   /transl_table=11
FT                   /locus_tag="Y11_04151"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27766"
FT                   /db_xref="GOA:E7BAF6"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF6"
FT                   /protein_id="CBY27766.1"
FT                   /translation="MKSIKLTVLAGILAGISGSAFALPNITLLATGGTIAGGGDSATKS
FT                   NYTAGKLGVDALVNAVPEMKKLANIQGEQVVNIGSQDMNDEVWLKLAKKLMLIVPKPTD
FT                   SSSLMGLIHWRKLLISSI"
FT   CDS             437091..437732
FT                   /transl_table=11
FT                   /locus_tag="Y11_04161"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27765"
FT                   /db_xref="GOA:E7BAF5"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF5"
FT                   /protein_id="CBY27765.1"
FT                   /translation="MVGAMRPATALGADGPLNLYNAVVVASDPNSAKRGVLVAMNDTVL
FT                   TGRDVMKTNTTSVQTFQSPNTGPQGYIYDGKVNYLHQPAPRQPAFDISKLNELPKVGII
FT                   YNYANASDLPAKALIEDGYKGIVSAGVGNGNLYKTVFDTLATAAHNGVAVVRSSRVPTG
FT                   STTEDAEVDDTKYGFVASGSLNPQKARVLLQLALTQTQKPQEIQKLFHAY"
FT   CDS             437879..438571
FT                   /transl_table=11
FT                   /locus_tag="Y11_04171"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27764"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF4"
FT                   /protein_id="CBY27764.1"
FT                   /translation="MKTFDFNRMALDKFPIEFLAEVGIRCLFTFVLVFLFLKLSGRRGV
FT                   RQMSLFEVVIILTLGSAAGDVTFYEDVPMLPVVMVFVSIMFLYRLSTFLMSRSEKIQRW
FT                   MEGKPLIIISDGIFVWETMQQENITHDEFFMELRQQGVEHLGQVRLAILEVNGAISVFF
FT                   FSKDKVKPGLPVLPKCCIKPLVNIEKLGEYACSQCSLIITLSNNSSATCQRCGHHHWVE
FT                   ALRHQREK"
FT   CDS             438814..439863
FT                   /transl_table=11
FT                   /locus_tag="Y11_04181"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27763"
FT                   /db_xref="GOA:E7BAF3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003248"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF3"
FT                   /protein_id="CBY27763.1"
FT                   /translation="MLPVEVLRRAEQELRNWHGLGTSVMEISHRSKEFLQVAEEAEKDL
FT                   RDLMQIPANYRVLFCHGGARAQFAAVPLNLLGDSHSADYIDGGYWAHSAVKEAQKYCTP
FT                   NVIDVTTHDNGVTGIAPMKQWKLSDNAAYVHYCPNETIDGLAINEEPDFGNKVVVADYS
FT                   SSILSRPIDVSRYGVIYAGAQKNIGPAGLTVVIVREDLLGKARTELPSILDYKVLAEND
FT                   SMFNTPPTFAWYLSGLVFKWLKEQGGLGEMGKRNQAKAELLYGAIDRTDFYRNQVATAN
FT                   RSWMNVPFQMIDPSLDKLFLSEAEAQGLQALKGHRVAGGMRASIYNAMPIEGVKALTDF
FT                   MADFERRHG"
FT   CDS             439990..441276
FT                   /transl_table=11
FT                   /locus_tag="Y11_04191"
FT                   /product="5-enolpyruvylshikimate-3-phosphate synthase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27762"
FT                   /db_xref="GOA:E7BAF2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF2"
FT                   /protein_id="CBY27762.1"
FT                   /translation="MLESLTLHPIALINGTVNLPGSKSVSNRALLLAALAEGTTQLNNL
FT                   LDSDDIRHMLNALQALGVKYRLSADRTRCEVDGVGGKLVAEQPLELFLGNAGTAMRPLA
FT                   AALCLGKNDIVLTGEPRMKERPIGHLVDALRQGGAQIDYLEQEHYPPLRIRGGFRGGKL
FT                   TVDGSVSSQFLTALLMTAPLAEQDTEIQIQGELVSKPYIDITLHLMKAFGVDVVHENYQ
FT                   IFHIKGGQTYRSPGIYLVEGDASSASYFLAAAAIKGGTVRVTGIGKKSVQGDTKFADVL
FT                   EKMGAKISWGDDYIECSRGELQGIDMDMNHIPDAAMTIATTALFADGPTVIRNIYNWRV
FT                   KETDRLSAMATELRKVGAEVEEGQDYIRVVPPAQLIAAEIGTYNDHRMAMCFSLVALSD
FT                   TPVTILDPKCTAKTFPDYFEQLARLSQMA"
FT   CDS             441515..442207
FT                   /transl_table=11
FT                   /locus_tag="Y11_04201"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27761"
FT                   /db_xref="GOA:E7BAF1"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF1"
FT                   /protein_id="CBY27761.1"
FT                   /translation="MTASAPVITVDGPSGAGKGTLCKALAESLDWRLLDSGAIYRVLAL
FT                   AALHHQVDISTEEALVPLAAHLDVRFVSQNGQLKVILEGEDVSNEIRTETVGNTASQAA
FT                   AFPRVREALLRRQRAFREPPGLIADGRDMGTVVFPDAPVKIFLDASSQERAHRRMLQLQ
FT                   EKGFNVNFERLLSEIQERDDRDRNRAIAPLVPATDALVLDSTSMSIEQVIEQALAYAQR
FT                   ILALPLKK"
FT   CDS             442376..444049
FT                   /transl_table=11
FT                   /locus_tag="Y11_04211"
FT                   /product="SSU ribosomal protein S1p"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27760"
FT                   /db_xref="GOA:E7BAF0"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAF0"
FT                   /protein_id="CBY27760.1"
FT                   /translation="MTESFAQLFEESLKTIETRPGSIVRGVVVSIDKDIVLVDAGLKSE
FT                   SAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWLMLEKAYEE
FT                   AATVTGVINGKVKGGFTVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKR
FT                   NNVVVSRRAVIESENSAERDQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITD
FT                   MAWKRVKHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQLGEDPWVAIAKRYPESTKLT
FT                   GRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERR
FT                   RISLGLKQCKSNPWQLFAETHNKNDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWN
FT                   VAGEEAVREYKKGDEIAAVVLQVDAERERISLGVKQLAEDPFNNYLSVNKKGAIVTGKV
FT                   TAVDAKGATVELAGGVEGYLRASEATRDRVEDATLVLNVGDEVEAKYTGVDRKNRVISL
FT                   SVRAKDEADEKDAIATVNNKPEEGNFSSAMAEAFKAAKGE"
FT   CDS             444197..444397
FT                   /transl_table=11
FT                   /locus_tag="Y11_04221"
FT                   /product="integration host factor beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27759"
FT                   /db_xref="GOA:E7BAE9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE9"
FT                   /protein_id="CBY27759.1"
FT                   /translation="MLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGAKVELE
FT                   GKYVPHFKPGKELRDRANIYG"
FT   CDS             444734..447019
FT                   /transl_table=11
FT                   /locus_tag="Y11_04231"
FT                   /product="putative hydrolase of the metallo-beta-lactamase
FT                   superfamily, clustered with KDO2-Lipid A biosynthesis
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27758"
FT                   /db_xref="GOA:E7BAE8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE8"
FT                   /protein_id="CBY27758.1"
FT                   /translation="MFITLSIDHAALAVIAGLLPLIVLPQLPGIRIISILLILGALLWV
FT                   SGNVYCQWLTLALVSFVWGCWQGDNLLMQIDRLTHREQQVVATINTSHLAWVEGNRVLL
FT                   DIQQVNGKRVFTAIKVTVTWQKGLNYCAGQQWKFWLRMRGVHSLLNEGGFDSQRWAIAN
FT                   RRPLQGRIIRAELLDATCNARQQTIRIVEQQLEPYRQRQILLALAFGERSQLDPQYWTL
FT                   LRDTGTAHLMAISGLHIAMAALLGGMLARGVQCLLPVSRIGPLFPLITSWFVAVIYAWL
FT                   AGANPPAMRAAMALTLWLLLRLFSVSCSAWQIWLWALALILLSDPLAILSDSFWLSCLA
FT                   VFSLICWFYWVPFAPCFRTGWQGLVIRGLHLQLGMMLLLIPLQIVLFHGISLLSIPANL
FT                   WAVPLVSLITVPCVLLALVFTLLPLVAGMFWSLADLSLTAVLLPLSPMRIGWLYTGSAS
FT                   VAIGFGGWLAMLIWRFSWWRNYSIGVMVLCVNLVLFTQRRDEYQWRVDMLDIGHGLAVV
FT                   IEREGKAIIFDTGNRWGTSSMASKVILPYLRWRGITIEQIILSHDHQDHTGGLAEIQAA
FT                   FPMATVRAPFPLKYAPNVLPCKQGLVWQWQGLNFEVLWPREQIINAQNDDSCVIRVGDG
FT                   KYSLLLTGDLEMRGEKALIKSSRAKLASTLLQVPHHGSNTSSTPPFLRAVKPELAFASV
FT                   ARYNQWHLPARKVTQRYQKNNIIWRDTSVSGQLSVYFYSDGLKINGYREQLTPRWYHQQ
FT                   FGVGGHNE"
FT   CDS             447055..448803
FT                   /transl_table=11
FT                   /locus_tag="Y11_04241"
FT                   /product="lipid A export ATP-binding/permease protein MsbA"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27757"
FT                   /db_xref="GOA:E7BAE7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE7"
FT                   /protein_id="CBY27757.1"
FT                   /translation="MMNDKDLSTWQTFRRLWPLISPYKTGLVVAAIALILNAASDTFML
FT                   SLLKPLLDDGFGKANSSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRL
FT                   FSHMMGMPVSFFDQQSTGTLLSRITYDSEQVAASSSGALVTVVREGASIIGLFIMMFYY
FT                   SWQLSLILIVIAPIVSVSIRLVSKRFRNISKNMQSTMGEVTTSAEQMLKGHKEVLIFGG
FT                   QKVENERFEAVSNRMRQQGMKLVSASSISDPIIQLIASFALAFVLYAASFPSVMETLTA
FT                   GTITVVFSAMIALMRPLKSLTNVNAQFQRGMAACQTLFTILDMEQEKDEGKLEVDRAKG
FT                   EIEFRHVTFYYPGKDTPALNDINMHIEAGKTVALVGRSGSGKSTIANLMTRFYDVSEGS
FT                   ILLDGHDLRDYRLGALRNQVALVSQNVHLFNDTVANNIAYARDEQYSRAEIEEAARMAY
FT                   AMDFINKMENGLDTVIGENGVMLSGGQRQRIAIARALLRDCPILILDEATSALDTESER
FT                   AIQSALDELQKNRTSLVIAHRLSTIEKADEILVIEDGRIVERGMHAELLAKKGVYAQLN
FT                   RMQFGQ"
FT   CDS             448800..449786
FT                   /transl_table=11
FT                   /locus_tag="Y11_04251"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27756"
FT                   /db_xref="GOA:E7BAE6"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE6"
FT                   /protein_id="CBY27756.1"
FT                   /translation="MIERIWSGKSWLYLLLLPLSWLYGAITWLIRISYTLGLRSAWRAP
FT                   VPVIIVGNLTAGGNGKTPVVIWLVEQLKQRGYRVGVVSRGYGGKSDVYPLLLSNSTTTS
FT                   QAGDEPVLIYQRTAAPVAVSPKRSDAVKALLKSHDLDFIITDDGLQHYALQRDFELVVI
FT                   DGVRRFGNGWWLPAGPMRERAGRLRSVDAVITNGGIAATGEIPMQLAAREAVNLVTGER
FT                   CPAQQLQHVVAMAGIGHPPRFFATLNLLGIAPKKEYAFDDHQDYSLAQLSSLTSGPQNL
FT                   LMTEKDAVKCRAFAQPNWWYLPVDAQLPPDQAEQLLLKIQPLSRRST"
FT   CDS             complement(449793..451199)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27755"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE5"
FT                   /protein_id="CBY27755.1"
FT                   /translation="MIHQPFVPPDDIRAKFSRAMSDMYQVEVPLYGALLQLVAETNHQT
FT                   MEQQPELSRHLRQTGEIERLNLERHGAIRVGTAAELATLRRLFAVMGMFPVGYYDLAPA
FT                   GVPVHSTAFRAVHEASLQASPFRIFTSLLRLELIEQPQLRQRAADILAKRNIFTPRAIE
FT                   LIVKHETAGGLTSQEADDFIIQSLETFRWHNQATVSAEVYQQLHDQHRLIADVVAFKGP
FT                   HINHLTPRTLNIDAVQVAMPQHNITPKAVIEGPPPRHCPILLRQTSFKAMEEKVAFISP
FT                   DGKIIQGHHTARFGEIEQRGAALTAKGRHLYDRLLQAAQDKLQVPANEKNAAQYMAILS
FT                   EQFSQFPDDYPTIRAEKLAFFHYFPTEKSLKAPTNLMQGLTLDELIDAEFIQFEPLVYE
FT                   DFLPVSAAGIFQSNLGDKEKSHFTGHSSKQSFQHHLGAEVIDELQLYEETQQRSLTACA
FT                   VALKLASLSL"
FT   CDS             451641..451850
FT                   /transl_table=11
FT                   /locus_tag="Y11_04271"
FT                   /product="cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27754"
FT                   /db_xref="GOA:E7BAE4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE4"
FT                   /protein_id="CBY27754.1"
FT                   /translation="MSKKTGQVKWFNEAKGFGFIEQHDGGKDVFVHFSAIATDGFKTLA
FT                   EGQRVEYTIQDSPRGPAAANVVAL"
FT   CDS             451871..451996
FT                   /transl_table=11
FT                   /locus_tag="Y11_04281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27753"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE3"
FT                   /protein_id="CBY27753.1"
FT                   /translation="MIQEIDDADVLIISPDSKILKPAFMRVFSYNQAHRGLIRKL"
FT   CDS             452066..452275
FT                   /transl_table=11
FT                   /locus_tag="Y11_04291"
FT                   /product="cold shock protein CspB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27752"
FT                   /db_xref="GOA:E7BAE2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE2"
FT                   /protein_id="CBY27752.1"
FT                   /translation="MTLKMGRVKWFNQSEGYGFISPHDGSLDVYVSKTAIANTKNKSLS
FT                   EGQDVEFSTYRSIHGPSAADVIAF"
FT   CDS             452707..452889
FT                   /transl_table=11
FT                   /locus_tag="Y11_04301"
FT                   /product="upf0434 protein YcaR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27751"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE1"
FT                   /protein_id="CBY27751.1"
FT                   /translation="MDHRLLEIVACPVCNGKLCFNKENLELVCKADNLAYPVRDGIPVL
FT                   LENEARPLSIDEKHA"
FT   CDS             452886..453638
FT                   /transl_table=11
FT                   /locus_tag="Y11_04311"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27750"
FT                   /db_xref="GOA:E7BAE0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAE0"
FT                   /protein_id="CBY27750.1"
FT                   /translation="MSFIAIIPARYASTRLPGKPLADIAGKPMVVHVMERALESGASRV
FT                   IVATDHPEVVTAVEAAGGEVCLTRADHQSGTERLAEVIERYGFADDQIIVNVQGDEPLV
FT                   PPEIIRQVAENLAASRAGMATLAVPIESSEEAFNPNAVKVVMDAQGYALYFSRAAIPWE
FT                   RERFAQSKETIGDCFLRHIGIYAYRAGFVRRYVNWAPSQLEQIELLEQLRVLWYGEKIH
FT                   VAVAKVVPAVGVDTQEDLDRVRAIMLNK"
FT   CDS             453828..454721
FT                   /transl_table=11
FT                   /locus_tag="Y11_04321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27749"
FT                   /db_xref="GOA:E7BAD9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD9"
FT                   /protein_id="CBY27749.1"
FT                   /translation="MEQLKAELSVVLGESITRLERISEQPYAHLYAMYNKQGQAIPLLA
FT                   KSYVCQGIAQQEAYKLSMLSREGDIRLPTVYGLVMTHQSPYKEILLMERLRGVSVEAPT
FT                   RTGERWNALMDQIVEGVLAWHRIDSHGCVGNVDSTQENDWFSWYQQRVEVLWATLSNMN
FT                   SPLMTLEDRAVLYRARASLNRFFAGFDDSSVLVHGNLTLRSMLKDPRSDQLLAMLNPGP
FT                   MLWAPREYDLFRLSEEGMPSQLFYRYLSKAPVSESFVARRWLYTLWELVSRFIHTGNLD
FT                   RTLFDNAAQQLLPWLE"
FT   CDS             complement(454724..455491)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04331"
FT                   /product="membrane protein functionally coupled to the
FT                   MukBEF chromosome partitioning mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27748"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD8"
FT                   /protein_id="CBY27748.1"
FT                   /translation="MLFTLKKFVGGLLMPLPFLLIVMGLALILLWFTRWQKSGKTLFTL
FT                   SWLALLLISLQPVADRLLLPLEKQYATYQGNDPVDYIIVLGGGYTFNPNWAPSANLFAN
FT                   SLPRVTEGIRLYRAHPNAKMVFTGSAGPNSQSSAKTAAQVAESLGVPAADIIALEQPKD
FT                   TVEEAAAVAALVGDKPFLLVTSASHLPRAIKFFTAKGLHPIPAPANQLAITTPLHSWER
FT                   TIPAAAYLGHSERAWYETLGLLWQKLTGNKNDE"
FT   CDS             complement(455558..455683)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27747"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD7"
FT                   /protein_id="CBY27747.1"
FT                   /translation="MDTCSAIVSITIDLPALIETRKSMATAKRMTTNLLFWHSLT"
FT   CDS             455682..456467
FT                   /transl_table=11
FT                   /locus_tag="Y11_04351"
FT                   /product="S-adenosylmethionine-dependent methyltransferase
FT                   Functionally Coupled to the MukBEF Chromosome Partitioning
FT                   Mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27746"
FT                   /db_xref="GOA:E7BAD6"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD6"
FT                   /protein_id="CBY27746.1"
FT                   /translation="MQDRNFDDIAEKFSRNIYGTTKGMIRQAVVWQDITGLLAQLPQRP
FT                   LRILDAGGGEGHMACQLAALGHQVLLCDLSAEMIQRAKVAAEEKGVSHNMQFVQSAAQD
FT                   ITQHLAQPVDLILFHAVLEWIAEPQQVLQILFNALNPGGALSLMFFNANGLVMRNAVLG
FT                   NFQLAIPGVKRRRQRSLSPQYPLDPPTVYGWLEQMGLSISGKTGVRVFHDYMKNKQQQV
FT                   DEFAELLALEQRYCRQEPFISLGRYVHVMAFKPNLKDPL"
FT   CDS             456464..457786
FT                   /transl_table=11
FT                   /locus_tag="Y11_04361"
FT                   /product="chromosome partition protein MukF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27745"
FT                   /db_xref="GOA:E7BAD5"
FT                   /db_xref="InterPro:IPR005582"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD5"
FT                   /protein_id="CBY27745.1"
FT                   /translation="MSEFSQTVPELVAWARKNDFSITLPTERLAFLMAIATLNGERLDG
FT                   EMSEGELVDAFRHVSKGFEQTTETVAVRANNAINDMVRQRLLNRFTSEMADGNAIYRLT
FT                   PLGIGITDYYIRQREFSTLRLSMQLSIVAQELQRAAEAAEEGGDEFHWHRNVFAPLKYS
FT                   VAEIFDSIDMTQRLMDEQQHSVKEDIAALLNQDWRAAIASCEMLLSETSGTLRELQDTL
FT                   EAAGDKLQANLLRIQEATIGNAGLDLVDKLVFDLQSKLDRIISWGQQAIDLWIGYDRHV
FT                   HKFIRTAIDMDKNRVFAQRLRQSVQNYFDSPWALTYANADRLLDMRDEELSLRSEEVTG
FT                   ELPPDLEFEEFNAIREQLAAMIEQALLVYQQQKLPLNLGEVMRDYLAQYPRARHFDVAR
FT                   ILVDQAVRLGVAEADFSGLPAEWLAINDYGAKVQAHVINKY"
FT   CDS             457767..458495
FT                   /transl_table=11
FT                   /locus_tag="Y11_04371"
FT                   /product="chromosome partition protein MukE"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27744"
FT                   /db_xref="GOA:E7BAD4"
FT                   /db_xref="InterPro:IPR007385"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD4"
FT                   /protein_id="CBY27744.1"
FT                   /translation="MSSTNIEVVMPVKLAQALANSLFPALDSQLRAGRHVGIDELDNHA
FT                   FLMDFQEQLEEFYTRYNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYL
FT                   SPERLAHEGIFAQHELYEELLSLADESKLLKFVNQRSTGSDLDKQKLQEKVRTSLNRLR
FT                   RLGMIYFMGNDSSKFRITEAVFRFGADVRSGDDPREAQLRMIRDGEAMAVENSLSLHDE
FT                   SDESDITMRNATDSAEDEQE"
FT   CDS             458492..462937
FT                   /transl_table=11
FT                   /locus_tag="Y11_04381"
FT                   /product="chromosome partition protein MukB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27743"
FT                   /db_xref="GOA:E7BAD3"
FT                   /db_xref="InterPro:IPR007406"
FT                   /db_xref="InterPro:IPR012090"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD3"
FT                   /protein_id="CBY27743.1"
FT                   /translation="MIERGKFRSLTLVNWNGFFARTFDLDELVTTLSGGNGAGKSTTMA
FT                   AFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLRAGVCYSTLDVVNSRHQRVIVGV
FT                   RLQQVAGRDRKVDIKPFTIQGLPTAIQPTQILTEVVGERQARVLSLQELKESVEAMEGV
FT                   QFKQFNSITDYHSLMFDLGVIPKRLRSSADRSKFYRLIEASLYGGISSAITRSLRDYLL
FT                   PENSGVRKAFQDMEAALRENRMTLEAIRVTQSDRDLFKHLISEATSYVAADYMRHANER
FT                   RIHLDGALVLRRELLASRKQLVTEQYRHVEMSRELAEQSGAESDLETDYQAASDHLSLV
FT                   QTAMRQQEKIERYQSDLEELTYRLEEQNEVVAEASEQQADNEARAEAAELEVDELKSQL
FT                   ADYQQALDVQQTRAIQYQQALQALERARALCQLPELTADNAEDWLETFQAKEQEATEAL
FT                   LQLEQKLSVADAAHSQFEQAYQLVVSIAGQVSRSEAWQTARELLRDWPSQQHLAERVQP
FT                   LRMRLSELEQRLRAQQDAERLLQEFCKRQGQAYQPEELEELQRELESTVEELSLSVSDA
FT                   GERRMEMRQELEQIKLKIQELTARAPVWLAAQDALSQLSEQSGEALEDSRQVTECMQQL
FT                   LERERETTVERDEVAATKRAIDVQIERLSQPSGAEDSRMIALAERFGGVLLSEIYDDVT
FT                   LDDAPYFSALYGPSRHGIVVPDLSLVRDQLAGLEDCPEDLYLIEGDPQSFDDSVFAVEE
FT                   LEKAVVVKIADRQWRYSRYPEVPLFGRAARENRLEALYQERDSLAERYATLSFDVQKTQ
FT                   RLHQAFSRFIGSHLGVAFDSDPEAEIRLLNTRRGEIERALNAHEERNQQQRQQFEQAKE
FT                   GISALNRLIPLVSLLLDDTLTERVEEITEELTEAQEAARHIQKHGASLTKLEPLLAVLQ
FT                   SDPQQHEQLKENYAQAQNSQRQAKQQAFALVEVVQRRAHFGYTDSAGMLTENSDLNDKL
FT                   RQRLEQAEAERTRAREQLRQYQVQFTQYNQVLASLKSSYDAKRDMLKELSQELVDIGVQ
FT                   ADANAEARARTRRDELHAALSTNRSRRNQLEKQLTFCEAEMDSLQKKLRKLERDYHQIR
FT                   EQVVNAKAGWCAVMRMVKDNGVERRLHRRELAYMDGDELRSMSDKALGALRLAVADNEH
FT                   LRDVLRMSEDPKRPERKIQFYIAVYQHLRERIRQDIIRTDDPVEAIEQMEIELGRLTEE
FT                   LTAREQKLAISSKSVSNIIRKTIQREQNRIRMLNQGLQAVSFGQVKSVRLNVNVREAHA
FT                   TLLDVLSEQQEQHQDLFNSNRLTFSEALAKLYQRLNPQMDMGQRLPQTIGEELLDYRNY
FT                   LELEVEVNRGADGWLRAESGALSTGEAIGTGMSILVMVVQSWEEESRRLRGKDISPCRL
FT                   LFLDEAARLDAKSIATLFELCERLEMQLIIAAPENISPEKGTTYKLVRKVFQNHEHVHV
FT                   VGLRGFANEIPALPSIPVEQ"
FT   CDS             463261..465132
FT                   /transl_table=11
FT                   /locus_tag="Y11_04391"
FT                   /product="L,D-transpeptidase YcbB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27742"
FT                   /db_xref="GOA:E7BAD2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD2"
FT                   /protein_id="CBY27742.1"
FT                   /translation="MSVEKRNPQRAFALYCALICSLMPTFTASAAAPIMPVDSSSARSP
FT                   ASQSMSVAQSRSQLLAVLPKNVTPFYSSELAVLYAANHMQPMWQDRAAVQHFQQQLAEL
FT                   ALSGIQPQFMQWVKWLSDPAITGLARDVILSDATLGYLHFISGVGANGSVWLYSNVPYK
FT                   MAMPPATILNRWQQAVHEGTTAPYLASLAPQHPQYEKMHQALKEMLADRRPWPQMANGP
FT                   SLRPGQLSDDIPALREILDRTGMLHPVVSAPVQIPEVIPVDNPAVAVVNDDLSVDEEKS
FT                   RAQAHSLVVSPSAAPPVADTPVTSGVVAPSSAPVTATVTDNVYTPELMEAVKRFQRWHG
FT                   LSDDGVIGARTREWLNVSPQTRATLLALNIQRLRILPGRVDNGIMVNIPNYSLNYYKNG
FT                   TQVLSSRVIVGRPSRKTPLMSSALNNVVVNPPWNVPTSLVRQDIVPKARYDSSYFQRHG
FT                   YTVLSGWSNDAEVVDPSMIDWSMISPNNFPYRLRQAPGASNSLGRFKFNMPSSDAIYLH
FT                   DTPNHGLFQKDIRALSSGCVRVNKASDLANMLLQDAGWNDARVSSTLKQGDTTYVNIRQ
FT                   RVPVQLYYLTAWVADDGKPQFRTDIYNYDMTVRSGSQISHQAELLLQ"
FT   CDS             465392..465940
FT                   /transl_table=11
FT                   /locus_tag="Y11_04401"
FT                   /product="exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27741"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD1"
FT                   /protein_id="CBY27741.1"
FT                   /translation="MDKIDNYRRKWLALGGAALGMSLLPGQAFATLSTPRPRILTLNNL
FT                   NTGESIKAEFFDGRSYNKDELSRLNHLFRDYRANKVKTIDPRLFDQLYRLQGLLGTTKP
FT                   VQLISGYRSLDTNNELRERSRGVAKHSFHTQGRAMDFHIEGIQLSNIRKAALKMRAGGV
FT                   GYYPRSNFVHIDTGPTRSW"
FT   CDS             466111..466845
FT                   /transl_table=11
FT                   /locus_tag="Y11_04411"
FT                   /product="hypothetical metal-binding enzyme, YcbL homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27740"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAD0"
FT                   /protein_id="CBY27740.1"
FT                   /translation="MDGPSNENSQHTCSLKDEGDIPKYWGWSFMKYQIIPVTAFSQNCT
FT                   LIWCEETGQAALVDPGGEAAKIIAEVARHHIQINQILLTHGHLDHVGAAAELAAHFQVP
FT                   IYGPEKEDTFWLEGLPAQSRMFGLNECEAFTPTRWLEEGDKITVGAIELSVLHCPGHTP
FT                   GHIVFIDQKDRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKLLPLGDDMTFIPGHG
FT                   PMSTLGHERQTNPFIREEPAVW"
FT   CDS             467144..468673
FT                   /transl_table=11
FT                   /locus_tag="Y11_04421"
FT                   /product="rtn protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27739"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC9"
FT                   /protein_id="CBY27739.1"
FT                   /translation="MPFRRFRLNKFLSRLGFSSMVLLLFLLLGAVVIYAQTKSNMHQNA
FT                   EVKLLQARVRFDQIFSNLQHAAIQVETGLGKPCLQVVQNLRDQVVLIPDVRSVSLTKGS
FT                   NIYCSSIYGPLSTPFDLDVFVDGQLELMQGNDVTPDRALMVYRLARGNYSILVAVDGYY
FT                   LRSILNLLSSDIELQLRVGDKWMDAAGIVHSGNPPNGGEPLYLSSEKYAYALSTALSNQ
FT                   QYLAYAWQYARGSLIFFILMSVGSAALVFWLSGRAASPTQVLKHALENNEFIPYLQPIV
FT                   SGKEQCWIGCEVLMRWQHPGQGLIQPNQFIPMAEDSELIVPMTRSIMQQVSAKFAPYVN
FT                   QLPEGFHFGFNISANHFRDLSLVDDCRNFIQAFGGNKINITLELTERKLIVADATTDKL
FT                   FAELHALGVFIAIDDFGTGHSSLTYLQKFKVDFLKIDQSFVGMIGSDALSSHIVGNVID
FT                   LATRLGLQTIAEGVENETQMRYLQAHNVDYLQGYMYGRPMPMNEFARYLFN"
FT   CDS             complement(468932..470122)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04431"
FT                   /product="aspartate aminotransferase( EC:2.6.1.1 )"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27738"
FT                   /db_xref="GOA:E7BAC8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC8"
FT                   /protein_id="CBY27738.1"
FT                   /translation="MFEKITAAPADPILGLTDIFRADDRPNKINLGIGVYKDETGKTPV
FT                   LTSVKKAEQYLLENEVTKNYLGIEGLPAFAHCTQELLFGANSTIITDKRARTAQTPGGT
FT                   GGLRIAADFIAHQTSAKRVWVSNPSWPNHKNIFAAAGLEVVEYAYYDAANHALDFDGLL
FT                   NSLSEARAGDVVLFHGCCHNPTGIDPTEAQWRQLAELSVAKGWLPLFDFAYQGFAKGLE
FT                   EDAQGLRIFAAQHQELIVCSSYSKNFGLYNERVGACTVVAASSEVADIAFSQVKAVIRA
FT                   NYSNPPAHGASVVATILSDKALRAIWEQELTDMRQRIHRMRQLFVNTLQEKGAKQDFSF
FT                   IINQNGMFSFSGLTKEQVLRLRNEFAVYAVNSGRVNVAGMTPDNMASLCEAIVAVL"
FT   CDS             complement(470378..471493)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04441"
FT                   /product="putative outer membrane porin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27737"
FT                   /db_xref="GOA:E7BAC7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC7"
FT                   /protein_id="CBY27737.1"
FT                   /translation="MMKRNILAVVIPALLVAGAANAAEIYNKDGNKLDLYGKVDARHQF
FT                   SDNAGQDGDESYVRFGFKGETQITDQLTGYGQWEYNVQANHAESQGDKGNKTRLGFAGL
FT                   KFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNYMTGRSTGLATYRNTNFFG
FT                   LVDGLNFALQYQGKNENDRSAVANGVYTGDNLKDQNGDGFGISSTYDIGYGVNFGAGFS
FT                   SSNRTNQQKAFSTAEGDKAQAWNVGAKYDANNVYLAVMYAETQNMTPYGDASNTIANKT
FT                   RDIEITAQYQFDFGLRPSLGYVQSKGKDLNANGDNQDLLKYVSVGSYYYFNKNMSTYVD
FT                   YKINLLDENDFTRANGLNTDDVVGVGLVYQF"
FT   CDS             complement(471792..473192)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04451"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27736"
FT                   /db_xref="GOA:E7BAC6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC6"
FT                   /protein_id="CBY27736.1"
FT                   /translation="MSVVPVVDVLQGRAAVDSEVTVRGWVRTRRDSKAGISFVAVYDGS
FT                   CFDPLQAVVNNTLPNYQDEVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAIKVVGWVD
FT                   DPDTYPMAAKRHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTP
FT                   LITASDTEGAGEMFRVSTLDLENLPRTDTGAVDFSEDFFGKEAFLTVSGQLNGETYACA
FT                   LSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGLAEKMLKYVFQAVLNER
FT                   ADDMKFFAERVDKDAVDRLQRFVTSDFAQVDYTDAIEILLASGQKFENDVSWGIDLSSE
FT                   HERYLAEQHFKAPVVVKNYPKDIKAFYMRMNEDGKTVAAMDVLAPGIGEIIGGSQREER
FT                   LDVLDARLAEMGLNKEDYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFP
FT                   RTPRNASF"
FT   CDS             complement(473449..474669)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04461"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27735"
FT                   /db_xref="GOA:E7BAC5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC5"
FT                   /protein_id="CBY27735.1"
FT                   /translation="MLYSAMTQDASPILTSLLDTDAYKLHMQQAVFHRYRHITVAAEFR
FT                   CRGDELLGKYADEIRHQITLMSQLALTDDEYQYLSGLPFFKNDYLNWLRAFRFNPEQVT
FT                   VSDNNSELDIRITGLWCETILWEVPLLAVISEIVHRSRSAHVTAEQAVSQLRSKLQQFN
FT                   VLSADIDITHFKLMDFGTRRRFSREIQHAIVNHLKDEFPHLVGTSNYDLARKLSLAPVG
FT                   TQAHEWFQAHQQISPVLANSQRVALQAWLDEYPNQLGVALTDCITMDAFLRDFDKTFAD
FT                   RYQGLRHDSGDPVEWGEKAIAHYEKLGIDPMSKTLVFSDNLDLEKALSLYRHFYQRVKL
FT                   VFGIGTRLTCNIPGVKPLNIVIKLVECNDKPVAKLSDSPGKTICHDPAFVDELREAFAL
FT                   PLVKKAS"
FT   CDS             475248..477863
FT                   /transl_table=11
FT                   /locus_tag="Y11_04471"
FT                   /product="membrane alanine aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27734"
FT                   /db_xref="GOA:E7BAC4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC4"
FT                   /protein_id="CBY27734.1"
FT                   /translation="MTQQPQVKYRHDYKSPDYTITDINLDFALDAQKTTVTAISQVKRQ
FT                   TADVTPLVLDGEDLTLVSISVDGQAWPHYQLQDNSLVIEQLPAHFTLTIINDIHPATNS
FT                   ALEGLYLSGEALCTQCEAEGFRHITYYLDRPDVLARFTTRIVADKALYPYLLSNGNRVG
FT                   QGVLDDGRHWVKWEDPFPKPCYLFALVAGDFDVLRDKFITRSGREVALELFVDRGNLDR
FT                   ADWAMTSLKNSMKWDETRFGLEYDLDIYMIVAVDFFNMGAMENKGLNVFNSKYVLAKAE
FT                   TATDKDYLNIEAVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDLGSRSVN
FT                   RIENVRVMRAAQFAEDASPMAHAIRPDKVIEMNNFYTLTVYEKGSEVIRMMHTLLGEQQ
FT                   FQAGMQLYFERHDGSAATCDDFVQAMEDASNVDLSLFRRWYSQSGTPILTVRDDYDAEK
FT                   QQYHLHVSQKTLPTADQPEKLPLHIPLDIELYDSKGNVIALQRNGLAVHHVLNVTEAEQ
FT                   TFTFDNVEHTPIPSLLREFSAPVKLDYTYSDQQLTFLMQHARNEFSRWDAAQSLLATYI
FT                   KLNVAKYQQKQPLSLPNHVADAFRAILLDENLDPALAAQILTLPSENEIAELFTTIDPQ
FT                   AISAVHEAITRCLANELSDELLAVYVANITPEYRIEHSDIARRALRNTCLNYLAFGDAE
FT                   FANKLVSSQYHQADNMTDSLAALAAAVAAQLPCRDELLAAFDVRWSHDGLVMDKWFALQ
FT                   ATSPAADVLTQVRALLRHPAFSLSNPNRTRSLIGSFASGNPAAFHATDGSGYQFLVEIL
FT                   SDLNTRNPQVAARLIEPLIRLKRYDSGRQTLMRQALEQLKTLDNLSGDLYEKITKALAA
FT                   "
FT   CDS             478031..479041
FT                   /transl_table=11
FT                   /locus_tag="Y11_04481"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27733"
FT                   /db_xref="GOA:E7BAC3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC3"
FT                   /protein_id="CBY27733.1"
FT                   /translation="MYYPLVKKALFQLDPERAHEFTFRQLKRLTGTPLQFLVSQSVPTK
FT                   PVSCMGLSFKNPLGLAAGLDKDGECIDALGAMGFGFIEVGTVTPKPQSGNDKPRLFRIV
FT                   EAEGLINRMGFNNHGVDNLIENVKKSHFGGILGINIGKNKDTPVEQGKEDYLICMDKVY
FT                   PYAGYIAINISSPNTPGLRSLQYGEALDDLLAAIKNKQTELHQRHHKYVPVAVKIAPDL
FT                   TEEELIQIADSLVRHNIDGVIATNTTLDRSLIQGLNYCEQAGGLSGRPLQLRSTEVIRR
FT                   LSQELQGRLPIIGVGGIDSVTAAREKMAAGASLIQIYSGFIFRGPGLIKNIVTHI"
FT   CDS             complement(479142..479267)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27732"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC2"
FT                   /protein_id="CBY27732.1"
FT                   /translation="MFGIKIPTPFIVWFNPHILPFPPRSPTLLTQQFELSLTQWD"
FT   CDS             479277..479774
FT                   /transl_table=11
FT                   /locus_tag="Y11_04501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27731"
FT                   /db_xref="GOA:E7BAC1"
FT                   /db_xref="InterPro:IPR009809"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC1"
FT                   /protein_id="CBY27731.1"
FT                   /translation="MLDLANGMIFRSRFPSKMLTPDAFDESAFCVDDAALYFEFEDQCR
FT                   QIKMGHEQRSELILNALVAFRFLKPLMPKSWYFAQQPKTWRPQNAELATVKVLENGEDI
FT                   SLLVVESGDTASLCLLAQSQVVLAGRQLVLGDAIKIMNDRLIPLVIEKPYTAPAFNLDR
FT                   AV"
FT   CDS             complement(479790..480902)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04511"
FT                   /product="flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27730"
FT                   /db_xref="GOA:E7BAC0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAC0"
FT                   /protein_id="CBY27730.1"
FT                   /translation="MVITLSRLYVHPVKSMRGLQLSHAQVSSSGLAFDRVFMITEPDGT
FT                   FITARQYPKMVMFTPALMSDGLYLTAPDGESASIRFNDFLANAEPTEVWGNHFTALIAP
FT                   AAINNWLSGYFQREVQLRWLGPELTRRVKPMPEIPLSFADGFPYLLINEASFKELQQRC
FT                   PSSIKPEQFRPNLLVTGASAFAEDSWQVIRVGDITFDLVKPCSHCVLTTVSVERGRKHP
FT                   TGEPLQTLQTFRTAENGDIDFGQNMVARNSGIIRVGDEVEVLSTKPPRPYGAGAVVESL
FT                   AAPEDKSKAVAIEYNGIRFNGNNQQILLEQLEQQNIRIPYSCRAGICGSCRIMLITGEV
FT                   APLKQSAIGNDGTILCCSCIPKGDIRLSGK"
FT   CDS             481002..483122
FT                   /transl_table=11
FT                   /locus_tag="Y11_04521"
FT                   /product="23s rRNA (guanine-N-2-)-methyltransferase rlmL"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27729"
FT                   /db_xref="GOA:E7BAB9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB9"
FT                   /protein_id="CBY27729.1"
FT                   /translation="MNSLFASTARGLEELLKSELEALGAHDCKIVQGGVHFQGDDRLMY
FT                   QSLLWSRLASRILLPLNDFKVYSDLDLYLGVQAIDWPSIFGVDKTFAVHFSGVNDEIRN
FT                   SQYGALKVKDAIVDSFTRKLDQRPTVAKQQPDIRVNVFLQREMASVALDLSGEGLHQRG
FT                   YRDLTGQAPLKENLAAAIIQRSGWQLGTPMVDPMCGSGTLLIEAAMMASDRAPGLHREH
FT                   WGFTAWSAFNEELWRELTTEAQVRARCGLQETTSRFFGSDIDRRVIEMARANARRAGVA
FT                   ELITFNANDVSKLVNPLPEGPVGTVISNPPYGERLDSEPALIALHNMLGRIMKTSFGGW
FT                   RLSLFSASPELLSCLQLRAEREFKAKNGPLDCVQKNYQLAANPQGAAGVQVAEDYANRL
FT                   RKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGSKVVVQEYAPPKTIDAQKARQR
FT                   LFDVINATLAVLNLPSNQLVLKTRERQKGKNQYEKLAQKGEFLLVSEYNAKLWVNLTDY
FT                   LDTGLFLDHRIARQMLGKMSQGKDFLNLFAYTGTASVHAGLGGARSTTTVDMSRTYLEW
FT                   AEKNLRANGLTGQQHRLIQADCLSWLSNTDEQFDVIFIDPPTFSNSKRMETTFDVQRDH
FT                   LVLMKELKRLLRRKGTIMFSNNKRGFQMDLDGIKALGLEAKEITAQTQSEDFARNRQIH
FT                   NCWLVTHSHEEK"
FT   CDS             483128..485041
FT                   /transl_table=11
FT                   /locus_tag="Y11_04531"
FT                   /product="ABC transporter ATP-binding protein uup"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27728"
FT                   /db_xref="GOA:E7BAB8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB8"
FT                   /protein_id="CBY27728.1"
FT                   /translation="MSLISMSGAWLSFSDAPLLDNTELHIEANERVCLVGRNGAGKSTL
FT                   LKILSKEVPLDDGRLIYEQDLIVARLQQDPPRNVAGTVFDFVAEGVQEQAEHLKSYHAT
FT                   LHQVELDPSEKNLNRLAALQEILDHQGLWQLDSRIQEVLKQLGLNADAELSSLSGGWLR
FT                   KAALGRALVSSPKVLLLDEPTNHLDIETINWLEGFLKEFQGSIVFISHDRSFIRAMATR
FT                   IVDLDRGKLVSWPGNYELYLASKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRN
FT                   EGRVRALKALRMERSQRREVMGTAKMQVEETVRSGKIVFDLENVNYQVGGKVLVKDFTA
FT                   QVQRGDKIALVGPNGCGKTTLLKLMLGQLKADSGKVHCGTKLEVAYFDQHRAELDPERT
FT                   VMDNLAEGKQEVMVNGRSRHVLGYLQDFLFHPKRAMTPVKALSGGERNRLLLAKLFLKP
FT                   SNLLILDEPTNDLDVETLELLEEMVDSYQGTVLLVSHDRQFVDNSVTECWIFEGNGQIS
FT                   SFVGGYYDAHQQRAEAKPIRQVAAKVEETKVAAPVKSTTPAAKRPGKLSYNLQRELDQL
FT                   PQQLEKLEHEIGKLQAEVSHADFFSRPHEETQQVLKALADAEQALEVAFSRWEELEAQK
FT                   NG"
FT   CDS             485260..486477
FT                   /transl_table=11
FT                   /locus_tag="Y11_04541"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27727"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB7"
FT                   /protein_id="CBY27727.1"
FT                   /translation="MSVALPSLPYGTKAVCPRCKTTLTARWDEPRKRPIGYAISALFML
FT                   LLANMFPFVNMRVAGITSEITLIQIPQVMVADDYASMATLFMVLVQLIPAFCMVAIILL
FT                   CLRVRMPHRWKALITKALFQFKTWCMVEIFLAGVLVSFVKLMAYGEIGIGSSFVPYCLF
FT                   CLLQVRAFQCVDRHWMWQDIAPAPALPHPLIAGRTGLRQGLRSCACCTAILPQDLVECP
FT                   RCHTHGYIRRRNSLQWTMALLVTSIMLYIPANLMPIMITESLGNQMNSTIMAGVIFLWS
FT                   EGSYPVAMVIFIASIMVPSLKMLAIGWLCWDAKGKGNTDTERMHFIYEIVEFVGRWSMI
FT                   DVFVIAVLSSLVRIGQLMSIYPAIGALLFAMVVILTMFAALTFDPRLTWDRISETTQKE
FT                   PQGDGQ"
FT   CDS             486464..488116
FT                   /transl_table=11
FT                   /locus_tag="Y11_04551"
FT                   /product="paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27726"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB6"
FT                   /protein_id="CBY27726.1"
FT                   /translation="MTDNNPSQGVAEIEKIKRWSPVWIIPIVTALIGAWILFYHFSHQG
FT                   PQVVMTTLNAEGIEAGKTKIKSRSVDVGIVEQVTLSEDLNHVIVKARLNSGMNTLLHSD
FT                   TVFWVVKPQIGREGVSGLGTLLSGAYIELQPGGKGKPLNEFALLDSPPLASPDAKGLRI
FT                   ILDSEQAGQLNAGDPVLFRGYRVGSVETSAFDAKSRLMRYQLFIGAPYDSLVTSNVRFW
FT                   KDSGVAVDLSSQGMRVEMASLATLFSGGVSFDVPDGLDPGKQITEAKAEFKLFDNRSSI
FT                   QNSLYTEHEDFLLFFSDSVRGLQSGAPVEFRGIRIGTVGDVPFFAEGMRQRVDNDFRIP
FT                   VLIRIEPGRFREDLGPDANFEKILKTAKERGLRASLKSGNLLTGALFVDLDFYPDAKPW
FT                   KGPLEVAGYPLLPTVSGGLAQIQQKVMQTLDKINSLPLDPMVTEVTKTLAESQKTMRET
FT                   QKTLESLTALTSSPAMQDLPKDLQKTLNELNRSMKGFQPGSPAYNKMVGDMQRLDQVLR
FT                   ELQPVLRTLNEKSNALVFEAAGSQDPQPKKAKK"
FT   CDS             488113..488664
FT                   /transl_table=11
FT                   /locus_tag="Y11_04561"
FT                   /product="putative lipoprotein protein YPO1422"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27725"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB5"
FT                   /protein_id="CBY27725.1"
FT                   /translation="MMKWMAVIAALLLSACSSTPSKTYYQLPALSAPAGATSSVASRQL
FT                   WVEHVSVADYLAAAGVVYQTNDVQYVIASNNLWASPLDQQLQQTLVTNLSNALPGWLVS
FT                   SQPLDSDQDVLNITVTGFHGRYDGRAIIRGVWILKRQGQLIKQPFDLELKQGEDGYDAL
FT                   IRTLAEGWQQEAKSIAAQLR"
FT   CDS             488942..489109
FT                   /transl_table=11
FT                   /locus_tag="Y11_04571"
FT                   /product="ribosome modulation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27724"
FT                   /db_xref="GOA:E7BAB4"
FT                   /db_xref="InterPro:IPR007040"
FT                   /db_xref="InterPro:IPR023200"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB4"
FT                   /protein_id="CBY27724.1"
FT                   /translation="MKRQKRDRLERALSRGYQAGISGRSREICPYQALDARSHWLGGWR
FT                   QAMEDRAVTA"
FT   CDS             complement(489168..490442)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04581"
FT                   /product="3-oxoacyl-acyl carrier protein synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27723"
FT                   /db_xref="GOA:E7BAB3"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB3"
FT                   /protein_id="CBY27723.1"
FT                   /translation="MNMRRVVITGMGVVSPLGCGIDMVWQRLLAGQSGIRILPDEIVGD
FT                   LPAKIGGQVPTLAADPEAGFDPDKAVAPKDQKKMDRFIEFAMAAADEAIAHAGWQADNE
FT                   EKQERTATIIGSGIGGFPSIANAVRTTDSRGPKRLSPFTVPSFLVNLAAGHVSIKHHFK
FT                   GPIGAPVTACAAGVQAIGDAVRLIRNDEADVALCGGAEAAIDKVSLAGFAAARALSTGS
FT                   NDAPEKASRPFDSARDGFVMGEGAGLLVIEELEHALARGAKPLAEIVGYGTSADAYHMT
FT                   SGAEDGDGAYRAMKIALRQAGITPAQVQHLNAHATSTPVGDLGEINAIKHLFGEGNTLA
FT                   VTSTKSATGHLLGAAGGLETIFTVLALRDQIVPATLNLENLDPAATGLKVIAGKAQPHE
FT                   MTYALSNGFGFGGVNASILLKRWVD"
FT   CDS             complement(490442..490984)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04591"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27722"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB2"
FT                   /protein_id="CBY27722.1"
FT                   /translation="MQRTRLQDMPCPVARSLKRVGEWWSILIIRDAFQGLTRFDEFQQS
FT                   LQLSPTILTRRLKYLVESGILEKQLYHARPARYEYLLTERGNDFFPVIAALFHWGNQHF
FT                   APDGPAVILTDRRTGTPVDPILLNNTTQQPIRAEDVTIAAGSVRSDIINKRLALMHEKN
FT                   VANVRYSPHSIESSKEK"
FT   CDS             complement(491335..491853)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04601"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27721"
FT                   /db_xref="GOA:E7BAB1"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB1"
FT                   /protein_id="CBY27721.1"
FT                   /translation="MVDKRESYTKEDLEASGRGELFGAGGPPLPAGNMLMMDRVVKMTE
FT                   DGGTYGKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKG
FT                   RALGVGEVKFTGQVLPDAKKVTYRINFKRIIMRKLIMGVADGEVLVDGKVIYTATDLKV
FT                   GLFKDTNAF"
FT   CDS             complement(491922..493544)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04611"
FT                   /product="putative protease La homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27720"
FT                   /db_xref="GOA:E7BAB0"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAB0"
FT                   /protein_id="CBY27720.1"
FT                   /translation="MTLFCHPQSLPRFMLIKAQESTEYLALIAQAVKELQPEASGLFGG
FT                   DYLVHGHQVNWQPAQRGDEPFAAMSRCLYQEWVEPEQLFGCVRWHKDQITLQPGLVHQA
FT                   NGGVLILSVRSLQAQPLMWLRLKQMIVQQRFDWLSPDETRPLPVHIPSMPLDLRLILIG
FT                   DRLGLGDFHDMEPELGELAIYGEFEVELPLVDIDGMTLWCGYINALLQQKQLPSLSADA
FT                   WPVLFRQAVRYSGDQGSLPLCPQWLTRQLAEAALYAEEDTITANALEVALNARDWRNSY
FT                   LAERMQDEIELGQILVETEGQVVGQINGLSVLEYPGHPYAFGEPARISCVVHLGDGEFV
FT                   DVERKAELGGNIHAKGMMIMQAFLISELELDQPLPFSASIVFEQSYGEIDGDSASLAEL
FT                   CALVSALSQQPINQQIAVTGSVDQFGNVQPIGGVNEKIEGFFEACQRRGLTGSQGVILP
FT                   ATNVRHLCLNQAVIEAVQQGQFHLWAVDTVAEALPLLTGMAYADEQQPSLLGIIQERIS
FT                   QVNPQDRRRWPWPLRWLNWFNQG"
FT   CDS             493884..494339
FT                   /transl_table=11
FT                   /locus_tag="Y11_04621"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27719"
FT                   /db_xref="GOA:E7BAA9"
FT                   /db_xref="InterPro:IPR009390"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA9"
FT                   /protein_id="CBY27719.1"
FT                   /translation="MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLM
FT                   KLESEPVKVLEWIDTHMNMQLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRL
FT                   AALAKRRGNTLSETVVQLIEDAERKEKYQNQMSSLKQDLQDILGKDV"
FT   CDS             complement(494470..495543)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04631"
FT                   /product="outer membrane protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27718"
FT                   /db_xref="GOA:E7BAA8"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR002368"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA8"
FT                   /protein_id="CBY27718.1"
FT                   /translation="MKKTAIALAVALAGFATVAQAAPKDNTWYTGGKLGWSQYQNTGTG
FT                   GIYGDQGNDGPTHKDQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVRNGDFKAQGV
FT                   QLAAKLSYPIAQDLDLYTRLGGMVWRADSSAFDATTGARANNHDTGVSPLVALGAEYAW
FT                   TKNWATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRFGQEDAVAPIAPAPAPAPVVD
FT                   TKRFTLKSDVLFAFNKSTLKPEGQQALDQLYAQLSSIDPKDGSVVVLGFADRIGQPAPN
FT                   LALSQRRADSVRDYLVSKGIPADKITARGEGQANPVTGNTCDNVKPRAALIECLAPDRR
FT                   VEIEVKGYKEVVTQPQA"
FT   CDS             complement(495901..496407)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04641"
FT                   /product="cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27717"
FT                   /db_xref="GOA:E7BAA7"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA7"
FT                   /protein_id="CBY27717.1"
FT                   /translation="MRTQSLKPYNANYHSLITRNAQERVDTPTDSGLISELVYSENQPA
FT                   VAQLLLPLLQQLGKQSRWLLWLTPQQKLSRLWLQQSGLPMSKVVQARQINPLSTVDAME
FT                   KALLTGNYSVVLGWLPELSENDRIRLRMAAKLGNAYGFVMRPLNDTKLDQGQCATLKIH
FT                   SSLYH"
FT   CDS             496637..496996
FT                   /transl_table=11
FT                   /locus_tag="Y11_04651"
FT                   /product="DNA transformation protein TfoX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27716"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA6"
FT                   /protein_id="CBY27716.1"
FT                   /translation="MKKVSEHKIMQARCRFDFLGQITVRSQFGGYGLLANNIMFAVVSE
FT                   GELYLRANDLVENLFRTRGMVNLVYAKRGLPVSLRYYWVDSALWEDDLALRHFAKQSYK
FT                   GAKSEVLSKKVPRFV"
FT   CDS             496993..497271
FT                   /transl_table=11
FT                   /locus_tag="Y11_04661"
FT                   /product="DNA transformation protein TfoX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27715"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA5"
FT                   /protein_id="CBY27715.1"
FT                   /translation="MKDLPNLSASLERLLWKVGIQSAAELKLEGAKCCYLKLRTLRRTL
FT                   GVNVLLALAGAISGHHCAVLPLMLRSELIEWFEMHIQPADVAQYETI"
FT   CDS             complement(497308..499443)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04671"
FT                   /product="putative efflux (PET) family inner membrane
FT                   protein YccS"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27714"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA4"
FT                   /protein_id="CBY27714.1"
FT                   /translation="MLTFVTGLRRYIYNSSLLYHVRIFIALVGVTAVPWWIDQPKLTIP
FT                   LTLGVVAAALTDLDDRLAGRLRNLFITLICFFIASASIELLFPYPWFFALGLTFSTCGF
FT                   ILLGALGQRYATIAFGALLIAIYTMLGTSMYHIWYQQPLLLILGAVWYNVLTLCGHLIF
FT                   PIRPLQDNLARCYQHLAQYLEAKANLFDPDIEPDVNQPLIDVAMANGALVSTLNQAKTS
FT                   LVTRLKGDRGQRETRRTLHYYFVAQDIHERASSSHVQYQVLREKFRYSDVLFRFQRLLS
FT                   MQARACMKLSQSILMRQKYQHDPRFERAFTFLDAALARELAQNENVPQVKALSHLLKNL
FT                   RAIDAQLPGIESEQVLAEDPQTESRLSDDRLTGWSDIKLRISRHLTPQSALFRHAVRMS
FT                   VVLCVGYAFIQLTDMRHGYWILLTSLFVCQPNYNATRRRLALRIIGTLAGILIGLPILY
FT                   FVPSIEGQLILIVITGVLFFAFRNVQYAHATMFITLLVLLCFNLLGEGFEVAAPRVFDT
FT                   LLGCAIAWVAVSLIWPDWKFRQLPAVVHRTLNANCRYLDAILVQYYQGKDNSLPYRVAR
FT                   RDAHNCDAELASVISNMSAEPKNDKETQEAAFRLLCLNHTMLSYISALGAHREKLTNTA
FT                   TLNLLDDAICYVEGALEQEQPDSTKITQVLAGLLTRLQSCNPEPESKDQLVLQQIGLLL
FT                   ELLPELSELNKRIGQAD"
FT   CDS             complement(499468..499983)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04681"
FT                   /product="inner membrane protein YccF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27713"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA3"
FT                   /protein_id="CBY27713.1"
FT                   /translation="MAPVITHPHCGFFIQLGRLITMRTVLNILNFVLGGFFTTLGWLLA
FT                   TVVSVILIFTLPLTRSCWEITKLSFLPYGNEAIHVNELYPEKSNPLLTAGGSLLNIVWF
FT                   ILFGWWLCLSHIATGIVQCITIIGIPVGIANFKIAAIALWPVGRRVVSVEMAQQARIAN
FT                   AQRQYQQR"
FT   CDS             500115..502169
FT                   /transl_table=11
FT                   /locus_tag="Y11_04691"
FT                   /product="DNA helicase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27712"
FT                   /db_xref="GOA:E7BAA2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR022161"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA2"
FT                   /protein_id="CBY27712.1"
FT                   /translation="MELKATSFGKHLAQHPYNRVRLLNAGIEVCGDKHQYLIPFNQLVN
FT                   IQCKRGIVWGEMEFELPNQQVVRLHGTEWQETQRFYHHLLGIWQQWSEEMSRVCVDVLH
FT                   KQVELIKRIEQQDKWFKRSELSQVQASIREAFTSLPMPVQRLIEFDSCRTDYELCLRWL
FT                   EHGNRSVDRRNQQWTHRMLEEHQDFFQSVETSPLNESQSRAVVNGEDSVLVLAGAGSGK
FT                   TSVLVARAGWLLRRNEALPEQILLLAFGRQAADEMNSRIKQRLGVDDIQAKTFHALALQ
FT                   IIQQGSRKTPVISKLESDSQARRSLLIKHWQQQCSEKKAQAKGWREWLTDELEWDIDDG
FT                   EFWHDSRLAARLAGRLERWLGLMRMHGGSQAEMIEQADEEVRDLFQKRIRLMAPLLKAW
FT                   KAALKEEGAVDFSGLIHQAVNLLEKGRFVSPWKHILVDEFQDISPQRAMLLRVLRKQNK
FT                   QTCLFAVGDDWQAIYRFSGAELSLTTAFSQNFGESAECALDTTYRFNDRIGEVANRFIQ
FT                   QNPYQLKKPLNSLSQGNKKSVVILPSEQLESLLDKLSGFVKDDERILILARYHHLRPEI
FT                   LQKATTRWPKLTIDFMTIHASKGQQADYVIIAGLHEGNDSFPAVVRESILEDVLLPPPE
FT                   DFPDAEERRLLYVAMTRAKHQVWLLQDTANPSIFVNQLSELGVPTQRKP"
FT   CDS             complement(502232..502690)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04701"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27711"
FT                   /db_xref="GOA:E7BAA1"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA1"
FT                   /protein_id="CBY27711.1"
FT                   /translation="MELTTRTIAARKHIALVSHDHCKKSLLEWVMQNRDLLSQHELYAT
FT                   GTTGNLVQKATGIDVHCLLSGPMGGDQEVGALISEKKIDILIFFWDPLNAVPHDPDVKA
FT                   LLRLATVWNIPVATNRSTADFLIDSALFSGEVTIAIPDYDRYLQQRLK"
FT   CDS             complement(502894..503577)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04711"
FT                   /product="upf0319 protein YccT precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27710"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E7BAA0"
FT                   /protein_id="CBY27710.1"
FT                   /translation="MKFGLVVAGILAVCCSTSAIATTLKLAPEIDLLVVDGKNMSGSLL
FT                   KGADSLELNSGQHQILFKVAKPLPTDPKVLYSSPPLVVVFNTRNVRSVAIKLPVIETAR
FT                   DGIKFSKNPSYQLIGDNGRPLSVRHDVLHQDNLNTAATLETAMASYNVGQFGASVPSFA
FT                   TIPPSPVSAVPGTTIAVAGTNSPQKTTNLQGENVAEQMLQYWFLQADADTQQRFLLWAK
FT                   KQPLK"
FT   CDS             503889..504305
FT                   /transl_table=11
FT                   /locus_tag="Y11_04721"
FT                   /product="succinyl-CoA synthetase, alpha subunit-related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27709"
FT                   /db_xref="GOA:E7BA99"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA99"
FT                   /protein_id="CBY27709.1"
FT                   /translation="MHDKDIADILQQVKTIALVGASDNPTRPSYGVMNYLLEQGYQVTP
FT                   VSPKLAGKTLLGQQVYAELADIPYPIDMVDVFRNADAAYGVAQDAIAIGAKVLWLQIGV
FT                   INEQAATLAADAGLKVVMDRCPKIEIPRLGLEKE"
FT   CDS             complement(504388..504705)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04731"
FT                   /product="hemimethylated DNA binding protein YccV"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27708"
FT                   /db_xref="GOA:E7BA98"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR022866"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA98"
FT                   /protein_id="CBY27708.1"
FT                   /translation="MIASKFGIGQQVRHRLHGYLGVVIDIDPEYSLEPPAPDEVANNDT
FT                   LRLSPWYHVVIEDDEGQPVHTYLAEAQLTYEDMDAHPEQPSLDELAASIRHQLQAPRLR
FT                   N"
FT   CDS             complement(504768..505952)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04741"
FT                   /product="LSU m5C1962 methyltransferase RlmI"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27707"
FT                   /db_xref="GOA:E7BA97"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA97"
FT                   /protein_id="CBY27707.1"
FT                   /translation="MRLFLARGREKSLLRRHPWIFSGAVQRLEGNASAGETIDILDSQG
FT                   KWLARAAYSPESQIVARVWTFQQDEVIDSEFFVRRLQQAQSWRDWLAQRDGLNGYRLIA
FT                   GESDGLPGITIDRFQNFLVLQLLSAGAEHQRAALVSALQQCYPECSIYDRSDVSVRKKE
FT                   GLELTQGTVWGEMPPALLPITEHGMKLLVDIQHGHKTGFYLDQRDSRLAARNYADGRRV
FT                   LNCFSYTGAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDISKAEFIRDDVFQL
FT                   LRNYRAQGEKFDMIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSG
FT                   LMPTDLFQKILADAALDAGHDIQFIEQFRQAADHPVIATYPEGLYLKGFACRIM"
FT   CDS             506208..506417
FT                   /transl_table=11
FT                   /locus_tag="Y11_04751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27706"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA96"
FT                   /protein_id="CBY27706.1"
FT                   /translation="MTNKQTHLELTEKQKEEIDLIALQRVNAMNSDEFLCNTIDQKIHS
FT                   MEEHLKSYFQSRFSFHLKHKNSEK"
FT   CDS             506430..506795
FT                   /transl_table=11
FT                   /locus_tag="Y11_04761"
FT                   /product="sll0939 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27705"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA95"
FT                   /protein_id="CBY27705.1"
FT                   /translation="MENIKEIIIYLSQSLQLLLEFLSVICVFVGLVKSLPTAITNFKNQ
FT                   SILHLMRTRFGTWLALALEFQLAADILATTINPSMEELIKLAIIAVIRTFLNYFLSKEL
FT                   ESAESNFANASAHHGKK"
FT   CDS             506815..507093
FT                   /transl_table=11
FT                   /locus_tag="Y11_04771"
FT                   /product="acylphosphate phosphohydrolase,putative"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27704"
FT                   /db_xref="GOA:E7BA94"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR028627"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA94"
FT                   /protein_id="CBY27704.1"
FT                   /translation="MAKVCIAAYVYGVVQGVGFRYSTQRQALALGVTGYARNCDDGSVE
FT                   VVAYGEKQAVEQLMEWIKQGGPRGARVDRLLTEPYPSTPFETFKIRY"
FT   CDS             complement(507121..507450)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04781"
FT                   /product="tRNA 2-thiouridine synthesizing protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27703"
FT                   /db_xref="GOA:E7BA93"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA93"
FT                   /protein_id="CBY27703.1"
FT                   /translation="MLEFEGRTIETDAQGYLKDSTDWSEALAPILAEQEGITLTEPHWE
FT                   VVRFVRAFYQEFNTSPAIRMLVKAMAQKYGEEKGNSRYLYRLFPKGPAKQATKIAGLPK
FT                   PVKCI"
FT   tRNA            507705..507792
FT                   /locus_tag="Y11_t25250"
FT                   /product="tRNA-Ser-TGA"
FT   CDS             complement(507974..508087)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27702"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA92"
FT                   /protein_id="CBY27702.1"
FT                   /translation="MLVLDQTIFVWVFVFMNQLKKTQPIDHFLHKIKRIPL"
FT   CDS             508163..509692
FT                   /transl_table=11
FT                   /locus_tag="Y11_04801"
FT                   /product="cytochrome c552 precursor"
FT                   /EC_number="1.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27701"
FT                   /db_xref="GOA:E7BA91"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017570"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA91"
FT                   /protein_id="CBY27701.1"
FT                   /translation="MSLAEYFSSDCGFKNKKMTDWCKHWQRPVWKTHWGNYCEQIYKTD
FT                   VGRDIGSFGCRGGFSLSAAPTPPIEARNDKFAQQHVDQFTSWLKTKESGPREDALAEDP
FT                   NLVILWAGYPFAKDYNKPRGHAYAVTDVRETLRTAAPKTAEDGPLPMACWSCKSPDVAR
FT                   LINEQGEEGYFKGTWAKGGPEVVNQLGCADCHDTASADFEAGKPALVLSRPYIERALQS
FT                   INKPFEHVSRLDQQSMVCSQCHVEYHFAGKDKAVKLPWDQGTDVESMEKYYDEIAFADW
FT                   VHPLSKTPMLKAQHPEYETWRAGIHGKNNVSCIDCHMPKIQNAAGKVYTDHQIRNPFDS
FT                   FETTCVNCHTQDKKTLQDIVAERKASIQELKLNVEKQLVHAHYEAKAAWDAGATEQEMK
FT                   PILQDIRHAQWRWDYAIASHGIHMHAPDIGLRVLGGALNKAADARTKLARLLATKGINH
FT                   EIPLPDISSKLNAQKALGMDMDKLNSEKQEFLQQVVPAWDEQAKKAGRLSQ"
FT   CDS             509783..510349
FT                   /transl_table=11
FT                   /locus_tag="Y11_04811"
FT                   /product="cytochrome c-type protein NrfB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27700"
FT                   /db_xref="GOA:E7BA90"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017564"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA90"
FT                   /protein_id="CBY27700.1"
FT                   /translation="MRVLRSFCSAILLAVLTLYTLPTFATAPANAPPTQGSRHVVEPQR
FT                   NPDAACVQCHKEQKDELHGKHAGAINPNTQLAVTCTNCHGKAAILHRNGIKDVMRFNSD
FT                   MLNADKAMFSVSQQNSVCMSCHQPEKLREAFWPHDVHMLKLSCVSCHQLHPKTDPMHGL
FT                   DDKGRVRICVDCHRRQQELIPKDAP"
FT   CDS             510346..511017
FT                   /transl_table=11
FT                   /locus_tag="Y11_04821"
FT                   /product="nrfc protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27699"
FT                   /db_xref="GOA:E7BA89"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017567"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA89"
FT                   /protein_id="CBY27699.1"
FT                   /translation="MNTNRRHFIVSMGALIFMTGSSGRSLALSGTIDGVRYGMLHDETR
FT                   CIGCTACMDACREVNHVPAGVSRLNIIRSQPVGEFPAVKYQFYRHSCQHCDKAPCVDVC
FT                   PTGASYRDKATGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTNLKQG
FT                   KQPACVLSCPTKALTFGNLDSPDCELVKLLHQRTVYRAKLHLGTQPKLYRVPFQYGEIT
FT                   G"
FT   CDS             511014..511979
FT                   /transl_table=11
FT                   /locus_tag="Y11_04831"
FT                   /product="nrfd protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27698"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA88"
FT                   /protein_id="CBY27698.1"
FT                   /translation="MSPALNTPFHFESLVWDWPIAIYLFLIGVSAGMVVVSLLVKRRAL
FT                   GGDAAQSGLLKSTAIIAPLAIVLGLFILILHLTRPWTFWKLMFFYSTRSVMSLGVMLFQ
FT                   IYMVVLLVWLAVLFRHWITALLQPYPKLSWVSTLLNKLAPIEPKLEPLMMFLAVALGAY
FT                   TGFLLSALKTYPLLNNPVLPVLFLFSGVSSGIAATVLCSVAFFKEPLHSPALAFVHRLE
FT                   KPVVWLELFLLLAFFTGLWFGGGQKEVAVTVALGGGFWALMFWFWVIGCGMVLPLVLSR
FT                   YCSHNVRHRVSFLLTVSGLSLFGVFVLRFFILYAGQMTVV"
FT   CDS             511993..513882
FT                   /transl_table=11
FT                   /locus_tag="Y11_04841"
FT                   /product="cytochrome c-type heme lyase subunit nrfE,nitrite
FT                   reductase complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27697"
FT                   /db_xref="GOA:E7BA87"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA87"
FT                   /protein_id="CBY27697.1"
FT                   /translation="MTAELGLLLLLAAASLALLLGCLPFIAFHGRRMPLLFWLPSLSYG
FT                   VALFITLAMLTLGWCFVTDDFSVLYVAQHGNSRLPLFYKIAAIWGGHEGSMLFLLFALS
FT                   LWSAALALLRRHFPLRFLARSLGVMGWLLVIFSVFILFFSNPFARLFPTLGEGRDLNPM
FT                   LQDLALIFHPPLLYLGYSGFAVGFAFAVATLLEGKSGQNIARYSRPWILAAWSLLSIGI
FT                   LLGAWWAYSELGWGGWWFWDPVENASLLPWLTSTALLHVLALNERRGLYHQWGILLSLV
FT                   TFQLCLLGTFIVRSGVLTSVHAFAVDTARGEALLALFGIVTLISLMLFALRIRGNTRAA
FT                   DFSLFSLETLLLAALVLLSIAAVTVLIGTLYPLIFSALGLGSLSVGASYFNLTLTPFML
FT                   LLLLLMGWAPFADWQRSRKTTRWRLAVPALLAIPGALLSSGLYQSSWQPEMIPGITLAL
FT                   WVLFAPLFATKIRWRSWLIHGGVAISLLGMLFASYHSVEAGSRMSAGRQVTLAGYQFTY
FT                   QKTELLVGPNYTSERAHITVSQNGQPITMLLPERRHYTARETLLIEPAIASGPFADFYA
FT                   VLGDSLGSGEYSVRLYHKPMASWIWGGALIMVFGGVLALWRRGRAASDIAEDK"
FT   CDS             513912..514427
FT                   /transl_table=11
FT                   /locus_tag="Y11_04851"
FT                   /product="putative thiol:disulfide oxidoreductase, nitrite
FT                   reductase complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27696"
FT                   /db_xref="GOA:E7BA86"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA86"
FT                   /protein_id="CBY27696.1"
FT                   /translation="MLAFVLGLVLYSGLNRDPHHVELAEKNLPFPEFSLSELQQPEEKI
FT                   TRSQLLGKVTVINVWASWCASCKQELAVLGQIASSLNQVQFYGVNYRDDRQAALNTLHR
FT                   YSNPYQKNLYDPQGVLALAMGVYGTPETWLIDADGIIRQRYAGEMTQEIWQQQFAPLLT
FT                   QWAKVGSL"
FT   CDS             514424..514834
FT                   /transl_table=11
FT                   /locus_tag="Y11_04861"
FT                   /product="cytochrome c-type heme lyase subunit nrfF,nitrite
FT                   reductase complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27695"
FT                   /db_xref="GOA:E7BA85"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR017565"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA85"
FT                   /protein_id="CBY27695.1"
FT                   /translation="MKAMLLALSLLFSPWVFADLVDTYHFSSPQHQQQALALAKELRCP
FT                   QCQNQNLLESTSPIAQDLRLEVYRLVEAGHSSQEIMALMTQRYGDFVLYRPPLRSATWV
FT                   LWFGPGVLLVCLLGGIVLRIRNLSGSGSRGAR"
FT   CDS             514834..515502
FT                   /transl_table=11
FT                   /locus_tag="Y11_04871"
FT                   /product="cytochrome c-type heme lyase subunit nrfG,nitrite
FT                   reductase complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27694"
FT                   /db_xref="GOA:E7BA84"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA84"
FT                   /protein_id="CBY27694.1"
FT                   /translation="MLLAMGLALVLLVILIGLWWPWLRQYGRLSWRWPLGLSVLIPTLI
FT                   LLGYQQLGHYSLVQQEALRQQEAARLNSVVDKQSSDPTLFLLQQRIRQSPDNGELWFSL
FT                   AQHYLYRNEFEDALVALQQTERLQGVSAALDAARATLFYYQSGQKMTDDVVYWLQQALA
FT                   KDPLQYTALMLQANDNFTHARYAQAIAIWQQLLESDNPDIDRAVIIRAMTFARAMQPSS
FT                   "
FT   CDS             516241..516975
FT                   /transl_table=11
FT                   /locus_tag="Y11_04881"
FT                   /product="quorum-sensing transcriptional activator YpeR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27693"
FT                   /db_xref="GOA:E7BA83"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA83"
FT                   /protein_id="CBY27693.1"
FT                   /translation="MIIDYFDNESINEDIKNYIQRRIKTYGDLCYSYLVMNKKTPLHPT
FT                   IISNYPLDWVKKYKKNSYHLIDPVILTAKDKVAPFAWDDNSVINKKSTDSAVFKLAREY
FT                   NIVNGYTFVLHDNSNNMATLNISNGSDDSISFDERIEINKEKIQMLLIITHEKMLGLYQ
FT                   SNSDKNENRNTQIERDIFSPRENEILYWASVGKTYAEISIILGIKRSTVKFHIGNVVRK
FT                   LGVLNAKHAIRLGIELKLIKPI"
FT   CDS             complement(516968..517612)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04891"
FT                   /product="N-3-oxooctanoyl-L-homoserine lactone synthase @
FT                   N-3-oxohexanoyl-L-homoserine lactone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27692"
FT                   /db_xref="GOA:E7BA82"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA82"
FT                   /protein_id="CBY27692.1"
FT                   /translation="MLKLFNVNFNNMPERKLDEIFSLRKITFKDRLDWKVTCIDGKESD
FT                   QYDDENTNYILGTIDDTIVCSVRFIDMKYPTMITGPFAPYFSDVSLPIDGFIESSRFFV
FT                   EKALARDMVGNNSSLSTILFLAMVNYARDRGHKGILTVVSRGMFILLKRSGWNITVLNQ
FT                   GESEKNEVIYLLHLGIDNDSQQQLINKILRVHQVEPKTLETWPMIVPGIIK"
FT   CDS             517910..518281
FT                   /transl_table=11
FT                   /locus_tag="Y11_04901"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27691"
FT                   /db_xref="GOA:E7BA81"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA81"
FT                   /protein_id="CBY27691.1"
FT                   /translation="MDRSPPLFTNKKFVFLVATFCCLLWGSAYPAIKNGYALFHIAADD
FT                   IPSKMVFAGYRFLLAGLVLLLFAVSSGKAIGRLKKSQYKQIAILGLTQTTLQYVFFYIG
FT                   LAYTTGVKGSIMNATGTFF"
FT   CDS             518259..518843
FT                   /transl_table=11
FT                   /locus_tag="Y11_04911"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27690"
FT                   /db_xref="GOA:E7BA80"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA80"
FT                   /protein_id="CBY27690.1"
FT                   /translation="MRQAHFFSVLLAHYIYKNDRLTFNKIIGCALGFAGVMVVNFGSGL
FT                   MDFNFSLMGEGCVVLAAFILSAASIYGKRISQTMDTTVMTGYQLAIGGLVLTLGGYLFG
FT                   GYLSDFGWQALLLLAYLVLLSSAAFALWSLLLKYNRVGMVAPFNFLIPVSGAVLSAIFL
FT                   NESILEWKNAIALVLVCVGIVLVNRIKQGRS"
FT   CDS             complement(518954..520681)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04921"
FT                   /product="cell volume regulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27689"
FT                   /db_xref="GOA:E7BA79"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA79"
FT                   /protein_id="CBY27689.1"
FT                   /translation="MDAITINSLFLIGAVLVGASILLSSLSSRLGIPILVIFLAIGMLA
FT                   GTDGIGGIAFDNYPVAYLVSNLALAVILLDGGMRTRASSFRVALWPALSLATVGVLITA
FT                   GLTGLAAAWLFDLDIIQGLLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDP
FT                   MAVFLTITLISMISAGESSLSWMFLVHLIQQFGLGIIIGLGGGGLLLSLINRIELPSGL
FT                   YPLLAVSGGILVFSLTTAMNGSGILAVYLCGLMLGNRPIRNRAGILQTFDGLAWLSQIG
FT                   MFLVLGLLLNPSELLPIAIPALILSLWMILFARPLSVFIGLLPFPSFNLRERIFISWVG
FT                   LRGAVPVILAVFPMMAGIPHANLFFNVAFFVVLVSLLLQGTSLSFAARKTKLVVPPALA
FT                   PVARIGLDIDKNNQWEQFIYQLSSDKWCIGAALRDLKMPQETRIAALFRGKDLLHPNGN
FT                   TRLKEGDILCVIGQEHHLPALGKLFSQSPSIQLDERFFGDFILDADAKLDDISQIYGLN
FT                   LEQGVDKQQTLGQFVLYLFGGEPVIGDQIEWDGLTWTIAEMESDRVSRVGVKIVTDKA"
FT   CDS             521144..522193
FT                   /transl_table=11
FT                   /locus_tag="Y11_04931"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27688"
FT                   /db_xref="GOA:E7BA78"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA78"
FT                   /protein_id="CBY27688.1"
FT                   /translation="MLKLRRRSVHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRV
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKTQPACQ
FT                   RVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAWLGLVPREFSSGGKQRLGRISKRGD
FT                   RYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHH
FT                   TEYRTLSAV"
FT   CDS             complement(522721..522966)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27687"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA77"
FT                   /protein_id="CBY27687.1"
FT                   /translation="MSKQESIENNPTSETTPVSEFSTLLALVNRLSGALDSAITGKDRS
FT                   VLVNELSQLSVDNLPEQEKAVTFEALKRALAALKRD"
FT   CDS             complement(523177..524316)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04951"
FT                   /product="glucans biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27686"
FT                   /db_xref="GOA:E7BA76"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA76"
FT                   /protein_id="CBY27686.1"
FT                   /translation="MKKNTNQREYFLDAIRAYLMLLGIPFHLSLIYSSNHWAVNSSHSS
FT                   LVFTLLNDFIHAFRMQVFFVISGYFSFMLYQRYERQRWLQVRLERVVIPLITAIPFITL
FT                   PQFFLLKNYTNKLQDWNSFTIYQKINIAIWEVVSHLWFLLTLALLTGLCFYLFQKMKNK
FT                   QASVPGLIKRMNNIGKVSLLLFVFIFIYSVIRRIIFLLNPEILFNSVFNFFVMETVFFL
FT                   PFFLLGAYSFIYPPLKQVFLTFSPGALIASILLFGAYYLNQHINTAEFFAFELDLIIKA
FT                   LIGVTMTNVVYSLGHRLLNYPSVRVTYLVNASLFIYLVHHPLTLIYGAFVTPQIDNNGL
FT                   GFILGMAFVCLISFMLYEVHRRIPLLKFLFSGKPQQQTA"
FT   CDS             524649..526202
FT                   /transl_table=11
FT                   /locus_tag="Y11_04961"
FT                   /product="glucans biosynthesis protein G precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27685"
FT                   /db_xref="GOA:E7BA75"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA75"
FT                   /protein_id="CBY27685.1"
FT                   /translation="MSKGSRAISVRWLGVTFLLSLFTSQVMAFSLDDVAKQAQALAGKS
FT                   FVAPKSNLPSQFREMKFADYQQIQFNHDKSYWNKLDTPFKLEFYHQGMYFDTPVQINEV
FT                   TATSVKPINYSPDYFNFGSVKHDPESVKNLGFAGFKVLYPINKADKKDEIVSMLGASYF
FT                   RVIGKGQVYGLSARGLAIDTALASGEEFPRFREFWIERPKPNDKHLVIYALLDSPRATG
FT                   AYKFIIYPGRDTTIDVQAKVFLRDKVEKLGIAPLTSMFLFGPSQPSAVLNYRPALHDSN
FT                   GLSIHAGNGEWIWRPLNNPKHLSVSTYTIENPKGFGLLQRGREFSQYEDLDDRYDLRPS
FT                   AWVEPRGDWGKGKVELVEIPTADETNDNIVAFWTPDVLPDAKTSLDLNYRLHFTRDEEK
FT                   LHSPDVAYVKQTLRSAGDVKQSNLIREPDGSVAFLVDFVGPVLKSLDENAPLASQVSID
FT                   DNGELIENSVRYNPVTKGWRLTLRLKVKDAKKPIEMRAALVNGDKTLTETWSYQLPANE
FT                   "
FT   CDS             526240..528777
FT                   /transl_table=11
FT                   /locus_tag="Y11_04971"
FT                   /product="glucans biosynthesis glucosyltransferase H"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27684"
FT                   /db_xref="GOA:E7BA74"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA74"
FT                   /protein_id="CBY27684.1"
FT                   /translation="MPLTAQQQGALRDALPEDVLLATTPDAIPRVHQQLAASTSETVVF
FT                   SEQDSALASVNARLQAAWPDALDDGKLLAQDDEGRTVIHATPPIKRTSMAPQAWRTNPV
FT                   GRFWDSLLGRSPVSRAQTHEQALAEKKWRSVGSLRRYILLILIVLQTAIATSYMKTILP
FT                   YQGWALIDPFAIWQQNWQVSVMQLLPYLLQTGILILFAVLFCWVSAGFWTALMGFLQLL
FT                   IGKDKYSISSTIKGDEALNPAHRTALIMPICNEDVERVFAGLRATYESVAATGQLEHFD
FT                   IYVLSDSYDPDICVAEQKAWLELCRDVDGHGRIFYRRRRRRVKRKSGNIDDFCRRWGSQ
FT                   YSYMVILDADSVMSGGCLTGLVRLMEANPNAGIIQSAPKASGMDTLYARIQQFATRVYG
FT                   PLFTAGLHYWQLGESHYWGHNAIIRVKPFIEHCALAPLPGEGSFAGAILSHDFVEAALM
FT                   RRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFL
FT                   TGVMSYLSAPLWFMFLVLCTALQAVHALMEPQYFLQPRQLFPVWPQWRPELAIGLFSTT
FT                   LVLLFLPKLLSIILIWAKGSKEYGGPIRLLLSMLAEMLFSILLAPVRMLFHTVFVVSAF
FT                   LGWSVQWNSPQRDDDATPWSEAMVRHGPQLMLGVVWASGVAWLDLRFLWWLSPIVFSLI
FT                   LSPVVSVLSSRRTLGLASKRAKLFLIPEEYNPPRELVATEEYLKLNHQRALSDGFFHAV
FT                   MNPSYNALVSAMATARHHTRAIIEQYRAERVAQALQAGPEKLAKLQRLELLSDPVIISR
FT                   LHQQVWQQPEQYQIWNGHYRQLAHNLQALPAAK"
FT   CDS             complement(529182..530231)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04981"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY25497"
FT                   /db_xref="GOA:E7AYZ3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7AYZ3"
FT                   /protein_id="CBY25497.1"
FT                   /translation="MLKLRRRSIHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQELSRWAKTQPACQ
FT                   RVMKVPGVGLMTATYLVASVGNGQQFHSAKQFAAWLGLVPREFSSGGKQRLGRISKRGD
FT                   RYFRYLLVHGARAVAAVIERHKDNMPWLYRLLNKKAYNVAVVAQANKTARILWSMLVHH
FT                   TEYRTLSAV"
FT   CDS             complement(530426..531961)
FT                   /transl_table=11
FT                   /locus_tag="Y11_04991"
FT                   /product="di-/tripeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_04991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27682"
FT                   /db_xref="GOA:E7BA72"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA72"
FT                   /protein_id="CBY27682.1"
FT                   /translation="MQTSTNTPGGRTFFGHPYPLSGLFLSEMWERFSFYGIRPLLILFM
FT                   AATVFDGGMGLPREQASAIVGIFAGSMYLAALPGGLLADNWLGQQRAVWYGSILIALGH
FT                   LSIALSAFFGNDLFFIGLVFIVLGTGLFKTCISVMVGTLYKPGDARRDGGFSLFYMGIN
FT                   MGSFIAPLLSGWLLRTHGWHWGFGIGGIGMLVALLIFRGFAIPAMKRYDAEVGLDSSWN
FT                   KPTNQRQGVGRWVTAIMAVVVVIIALISQGVIPINPVMIASLLVYVIAASVTLYFIYLF
FT                   AFAKMSRKDRARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTDRMVMGFEIPTVWF
FT                   QSINALFIILLAPVFSWAWPALAKKKIQPSSITKFVIGILCAAAGFAVMMYAAQHVLSS
FT                   GGAGVSPLWLVMSILLLTLGELCLSPIGLATMTLLAPDRMRGQVMGLWFCASSLGNLAA
FT                   GLIGGHVKADQLDMLPTLFARCSIALVICAAVLILLIVPIRRLMNNTQGQQTA"
FT   CDS             complement(532564..533397)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05001"
FT                   /product="multidrug-efflux transporter, major facilitator
FT                   superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27681"
FT                   /db_xref="GOA:E7BA71"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA71"
FT                   /protein_id="CBY27681.1"
FT                   /translation="MAVLALRALLGLLGGFIPNANALIATQVPRNKSGWALGTLSTGGV
FT                   SGALIWPLIGGLLADNYGLRPVFFITAAVLFACFVMTWFYVREQFAPVLKKDMLNGRQV
FT                   FNSLKNPKLILSLFVTTMIILIATGSIAPILTLYVRELAGDIHNLAFVSGMIASVPGVA
FT                   ALISAPRLGKLGDKIGPERILIAMLALSVLILIPMAFVQTPLQLGILRFLLGATDGALL
FT                   PAVQTLLIYNCTNQVAGRIFSYNQSFRDVGNVSGPLLGAAVSASYGFRAVFVSQR"
FT   CDS             complement(533995..534429)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05011"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27680"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA70"
FT                   /protein_id="CBY27680.1"
FT                   /translation="MLATLNLWFTRLTDHPNGGKLLLRLTFGVLMLFHGVAKIQHGTSW
FT                   IAASLQEQGIPGFVAYGVYIGEIVTPILIILGLFTRPAAFVYAVNLLVAVLMVGTGKFF
FT                   TLTQVGAWGLENEAMYFLGGVAIMLLGSGRYSVTKNEAYR"
FT   CDS             534950..535072
FT                   /transl_table=11
FT                   /locus_tag="Y11_05021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27679"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA69"
FT                   /protein_id="CBY27679.1"
FT                   /translation="MLTASPACWPMSCLDSELWPYQQGNRANKTALIVTYFINE"
FT   CDS             complement(535059..537962)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05031"
FT                   /product="putative insecticidal toxin complex"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27678"
FT                   /db_xref="GOA:E7BA68"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA68"
FT                   /protein_id="CBY27678.1"
FT                   /translation="MTTFNPRMHQDTPQINILDNRGFIIQEQQFCRTKISSAAVIQVSR
FT                   KKYNIQGQHIHSYDPRFSSQESIANFNYQYSLQGDMIKNNNLDTGENITLCDIEGRLVL
FT                   QKTASEVNKKFEYENNNSLGRMLTISEQLPDTHHWSTTDRFFYAEVSKENQARNLCGQI
FT                   IEHYDTAGMVNLESVSLIGIPTCQNRQLVSELAVDINWSDANQQSCRAKLNPTIFSTKT
FT                   TTDITGALLTQTDAVGNQQRYVYNRAGQLQTTWLKLHNQKENPILTFVNYNALGQKLRE
FT                   EYANGTIITYRYELATQRLVGMMTQQVKKVNQTRLLQDLRYQYDPVGNILVVHNDAEET
FT                   RFYSKQKIVPECNFTYDSCYQLIQATGRESSNNKQENNIPSKLTTQTSTNTHTLTNYQR
FT                   HYSYDKSGNMTNIKHIGATDYVNKIDISECSNHGLLNPGKINLSTSHIESNFDHSGNQK
FT                   TLSNGTSLIWNSRNELKEAIIIKRDIGVNDKENYLYDSKGERISKYTTTKALNAINTHK
FT                   VIYLLGVELHYKTVDNVVKESWQVITAFGNSNIQVRAIHWEMNKPKEIDNDQIRYSINN
FT                   LIGSTLLELDAQAQIISQEEYFPYGGTSVISSRNQIEASYRTIRYSGKERDVTGLYYYG
FT                   YRYYQAWVGRWLSADPAQTIDGLNLYRMVRNNPIAYHDSNGNQSTKNDRSLAVIDAYTR
FT                   IHEIKKSARQQIELLKSGSTKLALRAGTNFLLDISAAGINMGMATLVPLPGPAIISGLP
FT                   GTALGDITNRTTNMVSKKLIGGHIDLGLNLSGSTNKLDTTGVLQSYSEAFVHEHTYPFG
FT                   HGEIKSVTSAYDNISAAVEVNYNRAGLAKKLYSETNQALDIVEKCQSIALNIINHSQTD
FT                   KYHLSVLSRIKAWNRNTEYPVSIKDTIMHKKINAETIILAAYSAKNALEELRQVSRAIG
FT                   YPAVAWGERHTVRPPSQFEQYSRRRSTSHPMSEVTHL"
FT   CDS             complement(538113..539033)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05041"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27677"
FT                   /db_xref="GOA:E7BA67"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA67"
FT                   /protein_id="CBY27677.1"
FT                   /translation="MQAPSFNRSLLHPRYWLTWLGLGILYLLVLLPYPVIYTLGTSLGR
FT                   FAMRFLKRRKRITQRNLELCFPDMPKSERDELLLKNFESVGMGLFETGMAWFWPNWRIE
FT                   RWCSVSGLEHIQKARDEGKGVLLIGLHFLTLELGARILGIYNPGIGVYRPHDNKAMDWM
FT                   QTWGRMRSNKAMLDRKDLKGMIRSLKQGEIIWYAPDHDYGPRSSVFVPLFAVDQAATTT
FT                   GTYLLVRMAKPAIIPFTPRRLPDGKGYQLLLQPAVDNFPLDNEVEAAAFMNKVVEKEIE
FT                   RATDQYMWLHRRFKTRPEGAPSLYD"
FT   CDS             complement(539289..539873)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05051"
FT                   /product="tetrathionate reductase two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27676"
FT                   /db_xref="GOA:E7BA66"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA66"
FT                   /protein_id="CBY27676.1"
FT                   /translation="MSLIHLVDDDIAVTDACRFLLESLGYKVKVWHEGDRFLAQADLYQ
FT                   PGVVLLDIRMPLLDGTEVYARMRQLNSTLAVIFLTAHGEVPQAVEQMKLGAVDFLQKPV
FT                   ATAPLIAALQQGLVQSEQLVTRRQVQLRYASLTPREQMIAQWVMQGLINRDIADRACVS
FT                   VRTVEVHRAKVTEKMAVNSLAELVSLLNPIK"
FT   CDS             complement(539851..541611)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05061"
FT                   /product="tetrathionate reductase sensory transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27675"
FT                   /db_xref="GOA:E7BA65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA65"
FT                   /protein_id="CBY27675.1"
FT                   /translation="MYFRVLAIILFSCISAAHARDWTIGVLALRGDAQAQTHWQPLADN
FT                   LNQQLPEQHFQLLPLDLHAMKNAVAQNRIDFLLTNPAQYVQIDSHFPLRWLVSLRSSHE
FT                   PDGTSRNVIGSVILVRADSDIRSPLGLTGKRVGAVSPEAFGGYLLGYKALRDAGLQPEH
FT                   DFKLHFSGFPVDALIYLLRDRAISAAIVPTCLLEDMQAEGLVHARDFRPLLAKQATIPC
FT                   LTSTELYPNWSFAALSHVPDQLADNVTRILLNPADSKAPQWGAPSSTSQVETLLRSVNQ
FT                   HPQQPYFWQQIFDWAQQHRLLIAAIALILLLLGANHIWVAFLVRRRSRQLEQLHQQLRI
FT                   KEGALEQAQRLSILGEMASGFAHELNQPLSAIQHYADGCAIRLQREQADHPLLPILGQI
FT                   SQQAQRGADTIANLRLWAGKSPTSDRMTVSQPLPELLLHLWQLLGAEQHQPPCQLHTDI
FT                   DPQIALHLPPTLLDQVLCNLITNSLQAGARQLWFSAHQQANAVTLTLQDDAGGLTSEQL
FT                   SQPFAPFRSSKSEGLGLGLVICQRLINSQGGNLILHNQVATNGHIGLHVIVMLPLNPSK
FT                   ELSFVTDSPG"
FT   CDS             541750..542484
FT                   /transl_table=11
FT                   /locus_tag="Y11_05071"
FT                   /product="tetrathionate reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27674"
FT                   /db_xref="GOA:E7BA64"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA64"
FT                   /protein_id="CBY27674.1"
FT                   /translation="MDQGKRAFLQRLGVLTAGAALVPLADAGWQMEPVRKQGDIKRRYA
FT                   MLIDLRRCIGCQACTVSCAIENQLPQGQFRTTVNQYQIALSGAESVTNVLLPRLCNHCD
FT                   NPPCVPVCPVQATYQRQDGIVVIDNTRCVGCAYCVQACPYEARFINHSTQTADKCTFCV
FT                   HRLDAGLLPACVESCVGGARIIGDLRDGNSTLRKMLLEHAADIKVLKPEQGTHPQVFYL
FT                   GLNEVFTQSLQGQPALWQEVHA"
FT   CDS             542481..543566
FT                   /transl_table=11
FT                   /locus_tag="Y11_05081"
FT                   /product="tetrathionate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27673"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA63"
FT                   /protein_id="CBY27673.1"
FT                   /translation="MIHETMIREILARPQDIAWLPWAVQYFFFIGLACSAVLFAGGQRI
FT                   CARQGKLSAQQSQWEFTALMLAVSAVVVAPLALNADLHQPARVWHFYANFTPWSWMSWG
FT                   SIFLPLFSLLVMGYFLALIYSRLKDKPLPRLLAGLALLCGLSAISILLYTGREVSILRA
FT                   QPLWFSLWLPLFIFLTACQAIPSLLALWLWREPQYQRPLARWQLISLVVLAWVTLLWVY
FT                   SDKLWASGDNLSAQALRHWAVQSPFIALFPVALWLLLFGLALFNGRKTLSTPVIATQAL
FT                   SALTLCWSVRWLLLMETQTLPKYNVLANPYTLPLGSEGLLAIIGTFGLWVAAIIAIREG
FT                   VKWLEQKVTSANRVEGEIHHG"
FT   CDS             543559..546642
FT                   /transl_table=11
FT                   /locus_tag="Y11_05091"
FT                   /product="tetrathionate reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27672"
FT                   /db_xref="GOA:E7BA62"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA62"
FT                   /protein_id="CBY27672.1"
FT                   /translation="MAKSTRRQWLKGSLALGGVVAFGASYHAVARKTLTGLVDGSAGKL
FT                   TLDPISGNALPTEGRVGPQWQANSQQAVSMTQCFGCWTLCGLRVRVDTQQNKVLRIAGN
FT                   PYHPLSHDHHFPYQLPVDEALQRLGGEQGMTGRSTACARGATLLEGVDSPYRITEPMKR
FT                   VGPRGSGKWQRISFEQLVAEVTEGGDLFGEGPVEGLRAIRDLDTPIDAKQPSLGPKANQ
FT                   LLVTNAGDDGRDTFIQRFAHQAFGTKNLGSHGAYCGLAYRAGSGALMGDLDKNAHVKPD
FT                   WDNVRFALFLGTSPAQSGNPFKRQGRQLANARQRDDFNYVVVAPALPLTTTLANQHNRW
FT                   VPVLPGTDAALAMGIIRWIIEQHRFNHAYLAIPGEMAMQAAGERSWTNASHLVITTETH
FT                   PLAGQFLRANMLSGEAVAEGEESPVLAQAIDGTLQPADQMLQAELFATQDVILHDGQNV
FT                   QVQSGMTCLQQAAARFTLAEYSQQCGVPEATVIGLAREFTDYQRQAAVISHGGMMGGNG
FT                   FYTTWAVMMLNAMIGNLNLKGGVSVGGGKFDGFADGPCYQLATFVGMVKPKGLPLSRSK
FT                   QPYEKSEEYQQKIQQGQSGYPARGPWYPFVGGQLTEQLAPALAGYPYPLKAWISHMTNP
FT                   LYGVAGLRNLIEERLQDPRQLPLFIAIDAFMNETTALADYIVPDTHNFESWGVSAPWAG
FT                   VLVKASTARWPVVGPRTARTAQGEPVAMESFLIAVAKAMKLPGFGANAMQDSEGNSLSL
FT                   DRAEDYYLRAAANIAYGGEKPLPAAVDDELRLTGVDRLWPALQRSLYQDEQRRVAYLLA
FT                   RGGRFAPYEKSWNGDATGPQWKKPLQIWNENVAKHHHAITGERYSGCPTWYPPRLADGS
FT                   DVFQHYPVTDWPLRLMSFKSHLMSSSTAMIERLRAVKSTNLVAINPQDAQRNGIQHGDI
FT                   VRLMTPGGQMEVQVSLLDGVMPGVVAIEHGYGHREMGTRAHTLDGIVMASDPRIGQGTN
FT                   LNDLGFTDPTREVPNTWLDWVSGAAVRQGLPAKLQRIS"
FT   CDS             546783..546941
FT                   /transl_table=11
FT                   /locus_tag="Y11_05101"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27671"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA61"
FT                   /protein_id="CBY27671.1"
FT                   /translation="MTAAKLSAGLLVVGGILGYFGADWQSKTLLITAGVALLTGVVLSA
FT                   FTDRDCR"
FT   CDS             547119..548171
FT                   /transl_table=11
FT                   /locus_tag="Y11_05111"
FT                   /product="rhodanese-related sulfurtransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27670"
FT                   /db_xref="GOA:E7BA60"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA60"
FT                   /protein_id="CBY27670.1"
FT                   /translation="MPVLHNRISNEELKARMLAETEPRTTVSFYKYFILEDAKSFRDNL
FT                   YSQFVKLDVFGRVYVAKEGINAQISVPANRYDEFKVALFAAHPALDQVRLNVAHEDDGK
FT                   SFWVLRMKVRERIVADGIDDDSFDPSNVGHYLKADQVNQMIDDPDTLFVDMRNHYEYEV
FT                   GHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVY
FT                   HVEGGIIEYARKAKEQGLPLKFIGKNFVFDERMGERISDDVIAHCHQCGTPSDTHTNCK
FT                   NDGCHLLFIQCPACAAKFEGCCSPICQEELKLPQEEQRARRAGRENGIKIFNKSKGLLQ
FT                   TTMHIPMPDK"
FT   CDS             548272..549333
FT                   /transl_table=11
FT                   /locus_tag="Y11_05121"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27669"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA59"
FT                   /protein_id="CBY27669.1"
FT                   /translation="MTKPVVSGQGLRLVAMLAMLVVIMAGIKAASPIVVPFLLAIFLAI
FT                   VLNPLVKSLEKIKIPRTLAIVLLVTIIVLLMALLFSRLGSSLNEFARSLPQYRGMMLEK
FT                   MRDLQEFAMRFNIEFSVDDIMKHVDPSMAMNFITRLLSHLSGAMASTFLLLMTVVFMLF
FT                   EVERLPYKMQLMFDNPEQGNAILRRALNGVTHYLVIKTIISIATGIVIWLFLAAMGVRF
FT                   AFLWGLLAFVLNYIPNIGSVLAAIPPIIQALLFNGFADAFAVTGGYILINLIGGNIIDP
FT                   RMMGRGLGLSTLVVFLSLIFWGWLLGPIGMLLSVPLTIIAKIALELTPAGYKFAVLLSD
FT                   GKPAKTEAEKPIS"
FT   CDS             complement(549413..549526)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27668"
FT                   /db_xref="InterPro:IPR024494"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA58"
FT                   /protein_id="CBY27668.1"
FT                   /translation="MLNKLLSIVINNVREHLILYICLWLTLLALDIYFFFY"
FT   CDS             complement(549844..550428)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05141"
FT                   /product="putative LuxR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27667"
FT                   /db_xref="GOA:E7BA57"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA57"
FT                   /protein_id="CBY27667.1"
FT                   /translation="MKILIIDECFYTRSGVNTYLNNSTSLNLRDVPTVEQATSTIQDFN
FT                   PEIIIVNLTQYCRFGGHCPLLEHFLRCCDQAKVYIYLDAAYPFSETPIPLTGSVSILAK
FT                   KHLPELLQSLSRISHDSGKSHLSCPASLFSPQEHKVMCYWMTEMPNYRIAKKLNISDST
FT                   VYSHKRHITEKIKVRNRLELCFIYNVFKYLY"
FT   CDS             complement(550687..551832)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05151"
FT                   /product="N-methyl-L-tryptophan oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27666"
FT                   /db_xref="GOA:E7BA56"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023493"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA56"
FT                   /protein_id="CBY27666.1"
FT                   /translation="MIFTKVKNMDYDLIVIGSGSVGSAAGYYASQAGLKVLMIDSAMPP
FT                   HQSGSHHGDTRIIRHAYGEGEKYVPLVLRAQALWDQLSAQTGEKLFQASGVLNLGPDDS
FT                   TFLKNTQLSAQQYNLPVDILNAAQVREKWPVFTVPDNYIGVFEPQSGYLRSELAIKTLI
FT                   KAVTEAGCGILFNCPVTAIEPLDDGVDVVTIDGTYSARKVVVTAGTWVKELLPQLPITA
FT                   IRKVFSWHHADGRYSEGNHFPAFTVETPDNIHYYGFPSQNDELKLGKHNGGQPIESAAQ
FT                   RKPFGAYAEDGTEVFGFLRRFLPGVGVCLHGAVCSYDMSPDEDFIIDTLPDTPHIMVVT
FT                   GLSGHGFKFATALGEVAALFAQDKTSPIDISAFSLARFTHS"
FT   CDS             complement(552072..552326)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05161"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27665"
FT                   /db_xref="InterPro:IPR025730"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA55"
FT                   /protein_id="CBY27665.1"
FT                   /translation="MDRNDEVIQTHPLVGWDISTVDAYDAMMIRLHYLSSMDQPPEDAL
FT                   VDRTLWLTTDVARQLINILEAGIAKIESSEYQDLDRRKH"
FT   CDS             complement(552689..552934)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05171"
FT                   /product="DNA-damage-inducible protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27664"
FT                   /db_xref="InterPro:IPR010391"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA54"
FT                   /protein_id="CBY27664.1"
FT                   /translation="MRVEVSIDKKNQLPAGAIEALTNELSKRLNTKFPDTTTAVQVRYA
FT                   GANNLSVLGGAKTDKDLISEILQEIWESADDWFDAE"
FT   CDS             complement(553051..554097)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05181"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27663"
FT                   /db_xref="GOA:E7BA53"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA53"
FT                   /protein_id="CBY27663.1"
FT                   /translation="MTAQPQTLKIRRPDDWHIHLRDDEMLSTVLPYTSEVFARAIVMPN
FT                   LTPPITTVTSAIAYRERILTAIPAGHKFTPLMTCYLTNTLDVNELTLGFEQGVFTAAKL
FT                   YPANATTNSTHGVSDIPAIYPLFEQMQKIGMPLLIHGEVTDAAVDIFDREARFIDQILE
FT                   PICRQFPELKIVFEHITTKDAADYVLAGNRFLGATITPQHLMFNRNHMLVGGIRPHLFC
FT                   LPILKRSTHQEALRQAVASGSERFFLGTDSAPHAKHRKESSCGCAGVFNAPSALPAYAS
FT                   VFEEMNALQHLEAFCALNGPRFYGLPVNEDFVELVRVPFQQPEEISLGNESIIPFLAGQ
FT                   TINWSVKA"
FT   CDS             554324..554611
FT                   /transl_table=11
FT                   /locus_tag="Y11_05191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27662"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA52"
FT                   /protein_id="CBY27662.1"
FT                   /translation="MEVRVIASLVAKPEFIGEVTAAVHQVIEPSREEKGNLQYDLHAES
FT                   DQKGSFVFFERWASEDALEKHNKTAHFKAFVKAIEGKLESLEIKKVKQIA"
FT   CDS             complement(554681..558139)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05201"
FT                   /product="ribonuclease E"
FT                   /EC_number="3.1.26.12"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27661"
FT                   /db_xref="GOA:E7BA51"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR021968"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA51"
FT                   /protein_id="CBY27661.1"
FT                   /translation="MLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYKGKITR
FT                   IEPSLEAAFVDYGAERHGFLPLKEISREYFPSNYSSHGRPNIKDVLREGQEVIVQVDKE
FT                   ERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIEGDDRTELKEALSSLQLPDGMGL
FT                   IVRTAGVGKSADALQWDLSFRLKHWDAIKKAAEGRPAPFLIHQESNVIVRAFRDYLRPD
FT                   IGEILIDNPKVLELAKEHIAALGRPDFSSKIKLYSGEIPLFSHYQIESQIESAFQREVR
FT                   LPSGGSIVIDTTEALTAIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLI
FT                   VIDFIDMTPVRHQREVENRLRDAVRQDRARIQIGRISRFGLLEMSRQRLSPSLGESSHH
FT                   VCPRCSGTGTVRDNESLSLSILRLIEEEALKENTHEVHAIVPVQIASYLLNEKRESVNA
FT                   IEKRQGGVRAVIVPNDQMQTPHYSVLRVRKGEEVPSLSYLLPQLHEAEMAQPLEEAAIE
FT                   RKRPEQPALATFSLPTEVPPESAPAAANVKPTAAPQAATAAVAEQPGFLSRLFSGLKGL
FT                   FGGSTETEVKPVEVEKTETNENRRNDRRNPRRQNNGRKDRGDRTPREGRDNSSRDNNAR
FT                   DNSTRDNGNRDNANRDNSNREGRDDQRRNNRRPAQQATTPQAQTEVVEADKTQREEQPA
FT                   RRGDRQRRRPQDDKRQVSQDVKAKVDADIVTAVVEEAQPEQEERQQVMQRRQRRQLNQK
FT                   VRIQSANDELNVLESSVSEPVSHITAPVVQEEVKLLPQASSQADDEASNDRNGNNENGM
FT                   PRRSRRSPRHLRVSGQRRRRYRDERYPTQSAMPLAGAFASPEMASGKVWVRYPVAQPFE
FT                   PAFVENPVEEQQPVEQVQEVTAVVEQVAVVAAPVVVAAVAETVLPTPAPQHKPGGSSSS
FT                   AAAVPGRAPVVVETAIVETAIVETVTVAPIVETHAVEEPTQVTEIAPAAETITTVEPVI
FT                   EDAVATETVVEATIEPVAVVEEATQELVVEETAVVVDDVTVAEEAVVEDVTVEEAVVEA
FT                   PIVAETVVEDSVAEEATVTELPTDTAPVAVAPQQPVVAHPEGVLFKHYASAPMTKAPAP
FT                   DYQPASPSQGHWERPAFDFAGKGSAGGHAAATKATAPATKPQSVE"
FT   CDS             558726..559685
FT                   /transl_table=11
FT                   /locus_tag="Y11_05211"
FT                   /product="ribosomal large subunit pseudouridine synthase C;
FT                   LSU Psi955, Psi2504 and Psi2580"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27660"
FT                   /db_xref="GOA:E7BA50"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA50"
FT                   /protein_id="CBY27660.1"
FT                   /translation="MKTNNPAVQLITISADEAGQRIDNFLLTKLKGVPKSMIYRIVRKG
FT                   EVRVNKGRIKPEYKLADGDVVRVPPVRVAEREEIQVSAKLDKVAALADCILFEDDYLLV
FT                   LNKPSGTAVHGGSGLSFGVIEALRALRPEARFLELVHRLDRDTSGVLLVAKKRSALRSL
FT                   HEQLRLKGMQKDYLALVRGQWQSHCKAVQAPLLKNIMQSGERMVKVSSEGKPSETRFKI
FT                   EERFEHATLVKASPITGRTHQIRVHALHAGHPIAFDDRYGDREFDSQLQGTGLHRLFLH
FT                   AAALRFEHPNTGETMRIEAPLDNQLRHCLAVLRKKAAI"
FT   CDS             complement(559726..560307)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05221"
FT                   /product="Maf/YceF/YhdE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27659"
FT                   /db_xref="GOA:E7BA49"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA49"
FT                   /protein_id="CBY27659.1"
FT                   /translation="MPQLVLASTSSYRRALLEKLQLPFITAAPQADESPLQGESASTLV
FT                   QRLARAKAQALAAHYPQHLIIGSDQVCVINGAIVGKPHNHTNAVKQLEQASGQCVTFYT
FT                   GLALLNTATGSHDCLCETFDVYFRRLTSAEIEGYLVREQPWNCAGSFKSEGLGITLFDK
FT                   LSGRDPNTLIGLPLIALTQMLIEQGVNPLL"
FT   CDS             560449..560979
FT                   /transl_table=11
FT                   /locus_tag="Y11_05231"
FT                   /product="protein, clustered with ribosomal protein L32p"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27658"
FT                   /db_xref="GOA:E7BA48"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA48"
FT                   /protein_id="CBY27658.1"
FT                   /translation="MQKVKLPLTIDAVRTAQKRLDYAGIYSPEQVTRVADSVVSVDSDV
FT                   VASLSFNIDNQRLAVITGHADVDVTLMCQRCGNTFAHHVHTTYCFSPIVNDEQAEALPE
FT                   AYEPIEVDEFGEVDLLAMIEDEIILSLPVVPVHDSEHCEVSEADMVFGKLPEEAEKPNP
FT                   FAVLASLKKVIKE"
FT   CDS             560985..561152
FT                   /transl_table=11
FT                   /locus_tag="Y11_05241"
FT                   /product="LSU ribosomal protein L32p"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27657"
FT                   /db_xref="GOA:E7BA47"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA47"
FT                   /protein_id="CBY27657.1"
FT                   /translation="MAVQQNKPTRSKRGMRRSHDALTTATLSVDKTSGETHLRHHITAD
FT                   GFYRGRKVIG"
FT   CDS             561249..562223
FT                   /transl_table=11
FT                   /locus_tag="Y11_05251"
FT                   /product="phosphate:acyl-ACP acyltransferase PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27656"
FT                   /db_xref="GOA:E7BA46"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA46"
FT                   /protein_id="CBY27656.1"
FT                   /translation="MPASLQALASNPELKLLLVGNPDTITSLLVNADPLLLERLQVIPA
FT                   EHVIAGDAKPSQAIRASRGTSMRIALELVKNGDAAACVSAGNTGALMGLAKMMIKPLDG
FT                   IERPALMTVIPNQQRSKTVVLDLGANVECDSTMLVQFAVMGSVMAEEVVGITNPRVALL
FT                   NIGEEETKGLDNIREAAAVLKNTPTINYIGYLEGNDLLTGKTDVMVCDGFVGNVTLKTM
FT                   EGVIRMFLSLLKSSGEGKRQSWWLKLIGRWLQKRIAKRFGHLNPDQYNGACLLGLRGIV
FT                   IKSHGAANQRAFAVAIEQAVQAVQRQVPQRIAARLEAVLPKSD"
FT   CDS             562275..563183
FT                   /transl_table=11
FT                   /locus_tag="Y11_05261"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase,
FT                   KASIII"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27655"
FT                   /db_xref="GOA:E7BA45"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA45"
FT                   /protein_id="CBY27655.1"
FT                   /translation="MRSNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVASMGFHAAE
FT                   KALEMAGIDKNDIGLIIVATTSSSHAFPSSACQVQQMLGIKDAASFDLAAACAGFTYAL
FT                   SVADQYVKSGAVKHAIVIGSDVLSRALNPEDRGTIILFGDGAGAVVLGASEQPGILSTH
FT                   LHADGKYGELLALPYQDRQHQEQPAYVTMAGNEVFKVAVTELAHIVDETLQANNLDRSA
FT                   LDWLVPHQANLRIISATAKKLGMGMDKVVITLDRHGNTSAASVPAALDEAVRDGRIQRG
FT                   QLVLLEAFGGGFTWGSALVRF"
FT   CDS             563238..564167
FT                   /transl_table=11
FT                   /locus_tag="Y11_05271"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27654"
FT                   /db_xref="GOA:E7BA44"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA44"
FT                   /protein_id="CBY27654.1"
FT                   /translation="MSKFAMVFPGQGSQSLGMLADLAAQFPIVEETFSEASSVLGYDLW
FT                   QLVQQGPAEELNKTWQTQPALLTASVAIWRVWQHQGGKLPTMMAGHSLGEYSALVCAGV
FT                   LDFKQAVRLVELRGKLMQEAVPEGTGAMYAIIGLDNESIAKACEESALGQVVSPVNFNS
FT                   PGQVVIAGNKEAVERAGAACKALGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFQ
FT                   APLFPVVNNVDVKTEVSPEAIRSALVRQLYNPVRWAESVEFMAAEGIELLLEVGPGKVL
FT                   AGLTKRIVDTLAAAAVNDVATLTSTLEN"
FT   CDS             564181..564915
FT                   /transl_table=11
FT                   /locus_tag="Y11_05281"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27653"
FT                   /db_xref="GOA:E7BA43"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA43"
FT                   /protein_id="CBY27653.1"
FT                   /translation="MNFEGKIALVTGASRGIGRAIAELLAERGARVIGTATSEKGAEAI
FT                   SAYLGDQGKGLMLNVVDPASIESVLATIRAEFGEVDILVNNAGITRDNLLMRMKDEEWQ
FT                   DIIDTDLTSVFRLSKAVMRAMMKKRFGRIITIGSVVGTMGNAGQVNYAAAKAGLIGFSK
FT                   SLAREVASRGITVNVVAPGFIETDMTTALTDDQRAGILAQVPANRLGQAKEIASAVAFL
FT                   ASDEASYISGETLHVNGGMYMI"
FT   CDS             565069..565305
FT                   /transl_table=11
FT                   /locus_tag="Y11_05291"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27652"
FT                   /db_xref="GOA:E7BA42"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA42"
FT                   /protein_id="CBY27652.1"
FT                   /translation="MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVM
FT                   ALEEEFDTEIPDEEAEKITTVQAAIDFINANQQ"
FT   CDS             565436..566638
FT                   /transl_table=11
FT                   /locus_tag="Y11_05301"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase, KASII"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27651"
FT                   /db_xref="GOA:E7BA41"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA41"
FT                   /protein_id="CBY27651.1"
FT                   /translation="MLSPVGNTVESTWKAVLAGQSGISLIDHFDTSAYATRFAGLVKDF
FT                   NCEEFISRKDARKMDAFIQYGIVAGMQAMQDSGLEVTEANASRIGAAIGSGIGGLGLIE
FT                   ENHTALVNGGPRKISPFFVPSTIVNMIAGHLSIMCGMRGPSISIATACTSGVHNIGHAA
FT                   RIIAYNDADVMLAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKDRDGFVLGD
FT                   GAGMMVLEEYEHAKKRGAKIYAEVVGFGMSSDAYHMTSPPEDGSGAALAMVNALRDAGV
FT                   STSQIGYINAHGTSTPAGDKAETQAVKSVFGGDTKVMVSSTKSMTGHLLGAAGAVESIF
FT                   TVLALRDQAIPATINLDNPDEGCDLDFVPHEARQVTDLEYTLCNSFGFGGTNGSLVFRK
FT                   V"
FT   CDS             567053..567877
FT                   /transl_table=11
FT                   /locus_tag="Y11_05311"
FT                   /product="aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27650"
FT                   /db_xref="GOA:E7BA40"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA40"
FT                   /protein_id="CBY27650.1"
FT                   /translation="MFWINGVEQNLISASDRSVQFGDGCFTTARVSFGRVVWLDKHILR
FT                   LQLAAERLLMPAVNWNALTKEMVEAASHTEDGVLKVIISRGSGGRGYSGTTCQHPTRII
FT                   SLSDYPVHYHSWRERGISLALSPISLARSPLLAGVKHLNRLEQVLIRAHLEQTAADEAL
FT                   VLDTDGMLVECCAANLFWRKGDKIFTPDLSQSGVDGIMRQRIIACLAALGKPVAIVTQP
FT                   LNVLADADEIIVCNALMPLLPVNRIEPVNRAEPWVYHSRQLFDLLNLHCCEI"
FT   CDS             567939..568964
FT                   /transl_table=11
FT                   /locus_tag="Y11_05321"
FT                   /product="protein YceG like"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27649"
FT                   /db_xref="GOA:E7BA39"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA39"
FT                   /protein_id="CBY27649.1"
FT                   /translation="MKIKSTRALILFVAICLGLLLLAYQRVQHFADRPLAIQQETYFKL
FT                   PAGTGRVALENLLQRDGLIKNTRWFPWLLRLEPELAKFKAGTYRFTPGMTVRGMLELLA
FT                   SGKEAQFTVRFIEGKRLRDWMDELQQSKYIKHVLDGKSDAEIAVLLGLKDSEHPEGWLY
FT                   PDTYSYTAGTTDLALLKRAHVKMEKTVDEIWQGRDKSLPYKTPGDLVTMASIIEKETAV
FT                   NEERTKVASVFINRLRIGMRLQTDPTVIYGMGDSYDGTISRKDLDTPTPYNTYVISGLP
FT                   PTPIAMPGLASLTAAAHPAKTPYLYFVADGKGGHTFTTNLASHNQAVRVYRQSLKDKNE
FT                   Q"
FT   CDS             568954..569592
FT                   /transl_table=11
FT                   /locus_tag="Y11_05331"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27648"
FT                   /db_xref="GOA:E7BA38"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA38"
FT                   /protein_id="CBY27648.1"
FT                   /translation="MNSKFIVIEGLEGAGKTTARDTVVATLRAQGINDIVFTREPGGTP
FT                   LAEKLRDLIKQGIDGEVLTDKAEVLMLYAARVQLVENVIKPALARGSWVVGDRHDLSSQ
FT                   AYQGGGRGIDINLMTSLRDTVLGEFRPDLTLYLDLPPVIGLARARARGELDRIEQESLA
FT                   FFERTRERYLKLAATDSSIKTIDASQPLEQVSESISRVLKQWLTSRETA"
FT   CDS             569565..570599
FT                   /transl_table=11
FT                   /locus_tag="Y11_05341"
FT                   /product="DNA polymerase III delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27647"
FT                   /db_xref="GOA:E7BA37"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA37"
FT                   /protein_id="CBY27647.1"
FT                   /translation="MADQQRNSVMKWYAWLTAPYRQWVGQQTAGRGHHALLLHSLPGNG
FT                   EEALIYGISRWLMCQQRQGEKSCGECHSCRLMLAGNHPDWYVLTLEKGKSSLGVELVRQ
FT                   QIEKLYSHAQQGGAKVVWLPHAELLTDAAANALLKTLEEPPEKTYFLLDCHQPASLLAT
FT                   LRSRCFYWHLACPDTALSLQWLQRQIPAEPVSMLAALKLSEGAPLAAERLLQPERWATR
FT                   TTLCHALHSALHSSDLLSLLPQLNHDDAPERLQWISSLVLDALKWQQGAGQFAVNQDQL
FT                   PLVQQLAGMAATPVLLHSAQALGHCRHQLLSVVGVNRELLLTEFLLNWETALTTGTYST
FT                   LSSL"
FT   CDS             570614..571423
FT                   /transl_table=11
FT                   /locus_tag="Y11_05351"
FT                   /product="putative deoxyribonuclease YcfH"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27646"
FT                   /db_xref="GOA:E7BA36"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA36"
FT                   /protein_id="CBY27646.1"
FT                   /translation="MLLVDSHCHLDSLDYQTLHRNVDDVLAKAKARDVGFLLAVATTLP
FT                   GFLAMTSLIGERENVAFSCGVHPLNLEGGYDFEQLAKLAAADNVVAMGETGLDYFYQQD
FT                   NIPLQQASFREHIRIGRKLNKPVIVHTRDAREDTLAILHEEQAQECGGVLHCFTEDKAT
FT                   AATLLDLGFYISFSGILTFRNAEQLRDVARYVPLDRLLVETDSPYLAPVPHRGKENQPA
FT                   YVRDVAEYMAVLKGISLESLAQATTDNFCRLFHLDSARLTSGKPQLP"
FT   CDS             571731..573164
FT                   /transl_table=11
FT                   /locus_tag="Y11_05361"
FT                   /product="PTS system, glucose-specific IIB component; PTS
FT                   system, glucose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27645"
FT                   /db_xref="GOA:E7BA35"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA35"
FT                   /protein_id="CBY27645.1"
FT                   /translation="MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPTVVS
FT                   HVMAEAGGSVFANMALIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLP
FT                   AEEIAAKHLADTGVLGGIIAGAIAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGFTAIF
FT                   VGVILSFVWPPVGTAIQTFSQWAAYQNSVVAFGIYGVVERALVPFGLHHIWNVPFQMQI
FT                   GEYTNAAGQVFHGDIPRYMAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVG
FT                   GIMISAALTSFLTGITEPIEFSFMFVAPILYVIHAILAGLAFPICILLGMRDGTSFSHG
FT                   LIDFVVLSGNSSRIWLFPLVGICYGLVYYTIFRVLIAKLNLKTPGREDTTTEQTVQGGT
FT                   EMSAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAI
FT                   FGTKSDNLKTDMDEYIRNH"
FT   CDS             complement(573264..574181)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27644"
FT                   /db_xref="GOA:E7BA34"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR018061"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA34"
FT                   /protein_id="CBY27644.1"
FT                   /translation="MYFLPNKHTAAIIFALFFSVSSPTALGATVPEKVMHMPFVWDDTA
FT                   TPIVRIEINGIWENFMIDTGALIALHLFSDVIARLPGLIPEPGKHRTTDLTGKVFLNDK
FT                   FYIPKLSINGMEFKNVKGISVNTPQGMMFSPDSIPPHSMMIGLDLFKGKAVLIDYQKQR
FT                   LSVADNTQTLGINIADGWISLPLRLTQEGVEIKVIKNSKEYNMLLDTGATVSVFFKERL
FT                   KSPFVSLSCQTVIKEMDHEGCEASDFQLNEMGATEIGFNAVLLDGAFNQMDTDGLIGNN
FT                   FLKKFAVVLDFPEKRLLIKKFESA"
FT   CDS             complement(574162..576297)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05381"
FT                   /product="putative microcin H47 secretion ATP-binding
FT                   protein mchF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27643"
FT                   /db_xref="GOA:E7BA33"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA33"
FT                   /protein_id="CBY27643.1"
FT                   /translation="MIVAMKGYFEALRQRLPVVMQTEATECGLACMAMVAGYYGLNMDL
FT                   QALRKHYQVSLKGMSFRDLIVLADKLSLGSRPVRADLGSARQLKTPCILHWSFNHFVVL
FT                   KKFSRHGVTIIDPAKGERKISLTELSQHFTGIALEIWPNQHFQRRTEKKTIRLLNMFKN
FT                   VSGLSRALAHILALSFCIELLAMAVPLAAQFTLDMALRSGDINLISLITWGIIALLILR
FT                   ALLSLVRAWMVMSIKYTLGIQWNSGLFSHLIRLPVSYFEKRHIGDVRSRFNSLSVVQDA
FT                   FTAEMVASLLDIVVVIGLLFLMWVYDGYLAAIAVLISLTYAAIKFFLFGAYRSANLEAI
FT                   AHEAKQQSHFLETVRGIDCVKIFNLAERRRSDWINLVINEANAKIYLFKIDLATQTVGL
FT                   LLVGLSSAIILWLGAKLIDGGTLTTGMLFAFLIYSDMYVTRAIRVVDSIIRIRLIDMHS
FT                   ERLSEVALATPERATGEVDLDTPNSLAGSIEVKDLSYRYGDSEPAVFEHVNLSIKAGES
FT                   IAIIGPSGCGKSTLLKSMGGLVPQKCGSILLDGVDVRRLGLDTYRKHIAYVLQEDKLFA
FT                   GSLLDNISSFDIHPNSEWVLECARLASIHTEIDAMPMKYETMVGDMGSALSGGQRQRVS
FT                   LARALYKRPRILFLDEATSDLDIDNEARINDAIRALKITRIFVAHRPTMIAMADRVFDL
FT                   SKNAEMEKESPYVLFTQ"
FT   CDS             complement(576294..577577)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05391"
FT                   /product="putative microcin H47 secretion ATP-binding
FT                   protein mchF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27642"
FT                   /db_xref="GOA:E7BA32"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA32"
FT                   /protein_id="CBY27642.1"
FT                   /translation="MINNSAIFRREALEHRAHHWLGSPQVIIPVSASVWAMLALVLIAS
FT                   LIAFLVLGTYTQKARLAGSVVHHPAVARIIAPRDGIIVSSLAEEGKTVRAGEVIYVVNM
FT                   ETQTEFGGTRHETAAALKLQKATIEREIKLKSEAADIEQNFLLLSLENKEVEQQKMDDL
FT                   IGKSTQQTSWLLEKVQHFKELVRQGIALETEHMSRRSEYYSAAVQLENYKREKVRLQGE
FT                   IVNIKAQLAAIHSEIEVSLEILHRQTARLDQDLISIEEQRELQITSPIDGTLTGITGLA
FT                   GNTIRAAQELACVVPTSGQVEVEIFATADTIGELREGQAVRLRFDAYPYQWFGQYDGIV
FT                   RSISTTSVEQRLDISEKQAHQPQRHYFQVRIIPKNNAVVMAGETYPLRPGIGVQTDVFI
FT                   RKRPLYEWLLLPLKAARDTAQSHSGEVV"
FT   CDS             complement(577611..578795)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05401"
FT                   /product="galns arylsulfatase regulator (Fe-S
FT                   oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27641"
FT                   /db_xref="GOA:E7BA31"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA31"
FT                   /protein_id="CBY27641.1"
FT                   /translation="MPDLLIEKNIRHLEIILKISERCNINCDYCYVFNKGNSAADDSPA
FT                   RLSNKNIHHLVCFLQRACQEYKIGTVQIDFHGGEPLLMKKENFTNMCIQLTSGNYCGSN
FT                   IRLALQTNATLIDNEWIAIFEKYSVNVSISIDGPKHINDRHRLDTKGRSTYEATVRGLR
FT                   ILQHAYQQGRLPSDPGILCVANAQANGAEIYRHFVDELGVYSFDFLIPDDSYKDAHSDA
FT                   VGIGRFLNEALDEWVKDNNAKIFVRLFQTHIASLLGQKNSGVLGHTPNITGVYALTVSS
FT                   DGFVRVDDTLRSTSDKMFNPIGHLSEVNLSNVFASPQFQEYSSIGQSLPTECEGCIWEN
FT                   ICAGGRIVNRFSTEDRFKRKSIYCYSMRTFLSRSSAHLLNMGIEEERIMTSIRA"
FT   CDS             complement(578883..579044)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27640"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA30"
FT                   /protein_id="CBY27640.1"
FT                   /translation="MSRLKKEIIETKTVIDVSDTKKSQPQRLAEDVLEQIAGGAGWIKA
FT                   FGNWSRSF"
FT   CDS             complement(579438..581228)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05421"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27639"
FT                   /db_xref="GOA:E7BA29"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA29"
FT                   /protein_id="CBY27639.1"
FT                   /translation="MTSRRLEQQYLRLLNQVGVQPVEITLQELADKLNCTKRHMRTLLV
FT                   QMQQAGWLKWQAEAGRGRRSYLQLLRNTHQLLIEKAEQLLDSGGFNEAIALLGEDKQLI
FT                   TPLLRAKLGYRIRDDYQALRIPYYRTMTNLYPATALRRSELHLVRQTFNGLTRVNAENG
FT                   EVTTDLAHKWRMLDPLHWRFYLRPAVQFHDGRELSSRDVVSSLTRSATLPLFSHFQKIS
FT                   SHGPLSVVIELNQPDPRLPLLLAHHSALILPENHATQPDFASHPVGTGPYRVAENDNWH
FT                   LQMKSFDHYFGFRGLLDEVEVLIFPDLARPPSDTPAVLSEQLSMANIQSATWLSSSISD
FT                   IDYVSGKVASLTGKPSDSTQEMFLERGGYFLLCDSRSPHWHDIKQRRWLRKTLNPYHLI
FT                   QRLIESIRPFWVPASSVLPTWFHGIDAGEERSPFSSDIATESDDMPVLTLAYHAQHPEY
FT                   PMLVTEMTHILAAQGIKLDMIELDYTSWAKGEANVDLWLGTVNFAVPEEWNVGAWLLGS
FT                   PLLRQSITGGDEVSLQSYLHDWRNQSLSSEQLIREVIGSGWLQPLFHHWMRLKAPEQAQ
FT                   GAHLNNLGWFDFQTTWLEPE"
FT   CDS             581376..582197
FT                   /transl_table=11
FT                   /locus_tag="Y11_05431"
FT                   /product="shikimate 5-dehydrogenase I gamma"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27638"
FT                   /db_xref="GOA:E7BA28"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA28"
FT                   /protein_id="CBY27638.1"
FT                   /translation="MTRYLNKDTQVCISLAARPSNFGTRFHNFLYDAMDLDYLYKAFTT
FT                   TDLAAAIGGVRALGFRGCAISMPFKEAVIPLVDELDASAAAINSVNTLVNTNGYLKAYN
FT                   TDYIAIAKLLESYQVPTDKVFALRGSGGMAKAVAFALKNAGFKQGFIIATNEKTGKKLA
FT                   EQSGYTYQPDMQGVEADVLINATPVGMSGGKEADSMAFTATEVEHAEVVFDVVALPAMT
FT                   PLISYAKAQGKIVITGAEVFAIQAVEQFVLYTGIRPEQALFEKAAAYARAQ"
FT   CDS             582273..582626
FT                   /transl_table=11
FT                   /locus_tag="Y11_05441"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27637"
FT                   /db_xref="GOA:E7BA27"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA27"
FT                   /protein_id="CBY27637.1"
FT                   /translation="MAEETIFSKIIRREIPADVVYQDELVTAFRDIAPQAPTHILIIPN
FT                   ILIPTVNDVTAEHEATLGRMITVAAKLAEQEGIAEDGYRLIINCNRHAGQVVYHIHMHL
FT                   VGGRELGSLLSHK"
FT   CDS             582663..583052
FT                   /transl_table=11
FT                   /locus_tag="Y11_05451"
FT                   /product="ycfl protein: an outer membrane lipoprotein that
FT                   is part of a salvage cluster"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27636"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA26"
FT                   /protein_id="CBY27636.1"
FT                   /translation="MRPVKAFLLPVMALVCIATLLGCSSPKGIAVNKQQTVVMDSSVLT
FT                   AGILASQPAISTSSGNNVARSVITNSQSKPIKINYRFYWYDAQGLDVLPLEAPRFIVIA
FT                   PNDDVDIQSVNNNFNARSARLYLFL"
FT   CDS             583123..583704
FT                   /transl_table=11
FT                   /locus_tag="Y11_05461"
FT                   /product="lipoprotein YcfM, part of a salvage pathway of
FT                   unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27635"
FT                   /db_xref="GOA:E7BA25"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA25"
FT                   /protein_id="CBY27635.1"
FT                   /translation="MKRYLSVALAALVLTGCITQPPVEPTTPPVTIEPVTPPVPETPPQ
FT                   VDNVPPPPKMEQSIDWAASVEPLVAQMVNSNDVANGSILLLDSVKNNTNGRLQTAKATS
FT                   ALHQVLSSNKKFVLISPQQLAVAKQTLGLSEEDSLGSRSKAIGLARYVSAQYVLYSDVS
FT                   GDVKSPTIEMQLMQAQTGEIIWSGNGPVNR"
FT   CDS             583745..584605
FT                   /transl_table=11
FT                   /locus_tag="Y11_05471"
FT                   /product="thiamine kinase @ Adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.89"
FT                   /EC_number="2.7.1.156"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27634"
FT                   /db_xref="GOA:E7BA24"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014093"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA24"
FT                   /protein_id="CBY27634.1"
FT                   /translation="MDITPDGFIHAADFIKADWHISPVSGLTGESWRISYPSNTTANIN
FT                   WLAREQSVQKTQLGVDRRRERKLLQHVAGHHLAPTIIAADQHWLVVNWLEGDVVTCAQF
FT                   IELSNNGQLAQLLTRLHHLPASGYRLDLRAQLIRYAGQIDTKRLSPSWLRLHQHFQRRS
FT                   PPQPVKLAPLHMDIHPGNLLATPSGLKLIDWEYAADGDIALDIAALFRGNGWSAPQQQA
FT                   FLQHYCLNEQGYPDIDRLSRQIQRWVPWVDYLMLMWFEVRWQQTGDSEFLQWAAPLRQR
FT                   FNLSF"
FT   CDS             584640..585653
FT                   /transl_table=11
FT                   /locus_tag="Y11_05481"
FT                   /product="beta N-acetyl-glucosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27633"
FT                   /db_xref="GOA:E7BA23"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA23"
FT                   /protein_id="CBY27633.1"
FT                   /translation="MLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQI
FT                   RAASHERLVVAVDQEGGRVQRFRDGFTRLPAAQSFAAINDPATALQLAQDAGWLMAAEM
FT                   ISMDIDISFAPVLDIGHVSAAIGERSFHSDPQQALKMAECFIRGMHSAGMKTTGKHFPG
FT                   HGAVTADSHKETPRDNRPLAEIRTHDMVIFRELIARRLLDAIMPAHVIYTEADACPASG
FT                   SSYWLQTILRQELGFDGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGA
FT                   VSVLDNLSSVKADQLACLYHSGQFDRQALMASPRWQQANKALTALSERWDAHKSRG"
FT   CDS             585656..586198
FT                   /transl_table=11
FT                   /locus_tag="Y11_05491"
FT                   /product="ycfp protein: probably an esterase that is part
FT                   of a salvage cluster"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27632"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR022987"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA22"
FT                   /protein_id="CBY27632.1"
FT                   /translation="MIVYLHGFDSNSPGNHEKVLQLQFIDPDVRFISYSTLHPRHDMQH
FT                   LLKEVDKAIQQGGDAKSLICGVGLGGFWAERIGFLCGIRQVAFNPNLYPQDNMSGKIDR
FT                   PEEYVDIASKCISDFREKNLDRCLVVLSRNDEMLDSKRTAGDLHPYYEIVWDEKQGHKF
FT                   KDLSPHLQRIKAFKTLG"
FT   CDS             586577..587881
FT                   /transl_table=11
FT                   /locus_tag="Y11_05501"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27631"
FT                   /db_xref="GOA:E7BA21"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA21"
FT                   /protein_id="CBY27631.1"
FT                   /translation="MTTPKKKIVIIGGGAGGLELATSLGHKLGRSKKAEIILVDRNHSH
FT                   LWKPLLHEVATGSLDDGVDALSYLAHARNHYFNFQLGSLTDINRETKTVCLAEICDEHG
FT                   DVLVTKRELSYDILVVALGSTSNDFGTPGVKDHCIFLDNPHQAHRFHNEMLNLFLKYSA
FT                   QPGEKGKVNIAIVGGGATGVELSAELHNAVKQLHSYGFEGLDNQALNVTLVEAGERILP
FT                   ALPPRISAAAHQELIKLGVRVLTKTMVTSADEKGLNTKDGEFIHADLMVWAAGIKAPDF
FT                   MKDIAGLETNRINQLVVEPTLQTTRDPNIFAIGDCASCPQPSGGFVPPRAQSAHQMASR
FT                   CYSNILALLNEQPLKPYIYKDHGSLVSLSKFSTVGSLMGNLMRGSMMVEGRVARVVYIS
FT                   LYRMHQVALHGYTKTGLMMLVGGINRVIRPRLKLH"
FT   CDS             588262..588801
FT                   /transl_table=11
FT                   /locus_tag="Y11_05511"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27630"
FT                   /db_xref="GOA:E7BA20"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA20"
FT                   /protein_id="CBY27630.1"
FT                   /translation="MNKSMLAGVGIGIAAALGIAAVASMNVFSGAPQYAQVLAATPIKE
FT                   TIKTPRKECRNVTVTHRKPVQDENQIAGSVLGAVAGGVLGHQVGGGRGKDIATVAGALA
FT                   GGYAGNRVQSNMQDNDTYTTTQQRCQTVYDKSQKMLGYDVTYKIGDQQGKIRMDRDPGT
FT                   QIPIDKNGQLILNNRA"
FT   CDS             complement(588940..592386)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05521"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27629"
FT                   /db_xref="GOA:E7BA19"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA19"
FT                   /protein_id="CBY27629.1"
FT                   /translation="MSQQHRYSLPTRRGDTRQLGQLTGSACAVECAEIIERHDGPVMLI
FT                   TPDMQTALRLRDEIQQFSPHPVNTLSDWETLPYDSFSPHQDIISARLSCLYHLPTMERG
FT                   VIILPINTLMQRVCPHEFLHGHALVMKKGQHLSRDKLRAQLEQAGYRSVDQVMEHGEFA
FT                   TRGALLDLYPMGSEEPYRIDFFDDDIDSLRVFDVDSQRTLSEVDQINLLPAHEFPIDKN
FT                   AIELFRSQWREQFEVRRDAEHIYQQVSKGIWPAGIEYWQPLFFSQPLPTLFSYLPENTL
FT                   LINTGSLESSAERFWQDVNQRYESRRVDPMRPLLAPETLWLRVDSLFSELKEWPRVQFK
FT                   TEKLPTKTANTNLHYQPLPDLSVQAQQKAPLDNLRRFIESFSDSVVFSVESEGRRETLQ
FT                   DLLARIKISPTLISELSQATAPGHYLMIGASERGFLDTDKQLALICESDLLGERVNRRR
FT                   QDNRRTINTDTLIRNLAELRPGQPVVHLEHGVGRYLGLTTLEAGGIKAEYLILTYAGED
FT                   KLYVPVSSLHLISRYSGGADENAPLHKLGGDAWSRARQKVAEKVRDVAAELLDIYAQRT
FT                   AKSGFKFKFDREQYQLFCQSFPFETTPDQEQAINAVLSDMCRPLAMDRLVCGDVGFGKT
FT                   EVAMRAAFLAVANNKQVAVLVPTTLLAQQHFDNFRDRFATWPVRIEMMSRFRSAKEQQV
FT                   ILEQAAEGKVDIIIGTHKLLQSDLRWQDLGLLIVDEEHRFGVRHKERIKAMRADVDILT
FT                   LTATPIPRTLNMAMSGMRDLSIIATPPARRLAVKTFVREYDSLVVREAILREILRGGQV
FT                   YYLYNDVENIEKATQKLAELVPEARIAIGHGQMRERDLERVMNDFHHQRFNVLVCTTII
FT                   ETGIDIPSANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAYLLTPNPKAMTTDAKKRL
FT                   EAIASLEDLGAGFALATHDLEIRGAGELLGEDQSGQMTTIGFSLYMELLESAVDALKEG
FT                   REPSLEDLTSNQTEIEMRMPVLLPEDFIPDVNVRLSFYKRIASARDETELDELKVELID
FT                   RFGKLPDAARYLLHTAELRQQAQKLGIKRIEGNERGGFIEFGEKNKVDPVYLIGLLQRQ
FT                   PQIFRLEGPTKLKFMQDLSDRAKRLKFISELLAAFAQHRVA"
FT   CDS             592648..593850
FT                   /transl_table=11
FT                   /locus_tag="Y11_05531"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein LolC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27628"
FT                   /db_xref="GOA:E7BA18"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA18"
FT                   /protein_id="CBY27628.1"
FT                   /translation="MYQPVALFIGLRYMRGRASDRFGRFVSWLSTIGITLGVMALITVL
FT                   SVMNGFERDLQNNILGMMPQALITTPQGSLDPNKIPASSLKSLTGVTDIVPLTTADVVL
FT                   QSARNLSAGVMLGVDPNQHEPLADYLVNVHLKDLQPGSYNMILGEKLAGQLGVKRGETL
FT                   RLMVPSASQFTPMGRIPSQRLFNVIGTFAADSEVDGYQMLVNQQDASRLMRYPAGNITG
FT                   WRLFLSQPLSVDSLSQQTLPEGTVWKDWRERKGELFQAVRMEKNMMGLLLSLIIAVAAF
FT                   NIITSLGLLVMEKQGEVAILQTQGLSRRQIMLVFMVQGASAGVIGALLGAGLGILLASQ
FT                   LNTIIPVLGLLIDGATLPVEINPVQVTVIALLAMAIALLSTLYPSWRAAAAQPAEALRY
FT                   E"
FT   CDS             593843..594547
FT                   /transl_table=11
FT                   /locus_tag="Y11_05541"
FT                   /product="lipoprotein releasing system ATP-binding protein
FT                   LolD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27627"
FT                   /db_xref="GOA:E7BA17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011924"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA17"
FT                   /protein_id="CBY27627.1"
FT                   /translation="MSNHPLLQCLNLCKRYQEGQLHTDVLRNVSFTIEAGELMAIVGSS
FT                   GSGKSTLLHLLGGLDSPTSGEVIYQGRSLNQMSSTAKAELRNRELGFIYQFHHLLPDFT
FT                   ALENVAMPLLIGGAKPSEAQDKARAMLVAVGLEKRSKHRPSELSGGERQRVAIARSLVN
FT                   NPSLVLADEPTGNLDQRNADSIFNLLGELNVRQGTAFLVVTHDLQLAKRMSRQLEMRDG
FT                   QLQQHLTLVGAQ"
FT   CDS             594547..595806
FT                   /transl_table=11
FT                   /locus_tag="Y11_05551"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein LolE"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27626"
FT                   /db_xref="GOA:E7BA16"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR011926"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA16"
FT                   /protein_id="CBY27626.1"
FT                   /translation="MAIGMGVSPLSLLIGLRFSRGRRRGGMVSLISVISTLGIALGVAV
FT                   LIVGLSAMNGFERELKNRILAVVPHGEIAVVNQPFSGWPQTLQRIEKVPGIVAAAPYIN
FT                   FTGLIENGTQLRAVQVKGVDSEAEQRLSALPSFVLDHAWDNFKAGQQQIILGKGLADAL
FT                   GVKQGSWLTVMIPNSDPEMKLLQPKRIRLQVAGVFQLSGQLDHSLALVPLVDAQQYLDM
FT                   GDSVTGIAIKVDDVYNANKLVRSAGEVSNAYVYISSWIGTYGYMYRDIQMIRTIMYLAM
FT                   VLVIGVASFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFIWYGLMAGLIGSVSGA
FT                   VAGVIISLQLTNIIRGLEKLIGHQFLSGDIYFIDFLPSELHWFDVACVLATALVLSLIA
FT                   SWYPARRASRIDPARVLSGQ"
FT   CDS             596114..597028
FT                   /transl_table=11
FT                   /locus_tag="Y11_05561"
FT                   /product="latent glucokinase ycfX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27625"
FT                   /db_xref="GOA:E7BA15"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR023505"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA15"
FT                   /protein_id="CBY27625.1"
FT                   /translation="MYYGFDMGGTKIELGVFDANLQRIWHKRVPTPREDYSLLLQTLHN
FT                   LTREADEFCGIKGSVGIGIPGLPNADDGTVFTANVPAAMGQSLQGDLSGLIGREVRIDN
FT                   DANCFALSEAWDPEFRRYPTVLGLILGTGVGGGLIVNGNIVSGRNHITGEFGHFRLPVD
FT                   ALDILGADIPRVPCGCGHNGCIENYISGRGFEWMYKHFNQQSLPATEIIANYNIGESKA
FT                   VAHVERFMDVLAVCLGNLLTMLDPHLVVIGGGLSNFEHIYQELPKRLPQHLLRVARLPR
FT                   IEKARYGDAGGVRGAAFLHFSER"
FT   CDS             597089..597925
FT                   /transl_table=11
FT                   /locus_tag="Y11_05571"
FT                   /product="NAD-dependent protein deacetylase of SIR2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27624"
FT                   /db_xref="GOA:E7BA14"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA14"
FT                   /protein_id="CBY27624.1"
FT                   /translation="MRIRHRLCRFRKNKHLRHQRFRSRIFHRDSAATSEMKKPFVVVLT
FT                   GAGISAESGIRTFRAADGLWEEHQVEDVATPEGYRRDPELVQAFYNARRRQLQQPDIAP
FT                   NAAHFALADLEAVLGDNFVLVTQNIDNLHERAGSKRVIHMHGELLKVRCTQSGQVLDWP
FT                   CDLSADERCHCCQFPSPLRPHIVWFGEMPMGMDEIYQALAEADFFISIGTSGHVYPAAG
FT                   FVHESSLHGAHTVELNLEPSQVESQFDEKHYGLASKVVPEYVREFLTTRGENRQGD"
FT   CDS             598095..599330
FT                   /transl_table=11
FT                   /locus_tag="Y11_05581"
FT                   /product="tripeptide aminopeptidase"
FT                   /EC_number="3.4.11.4"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27623"
FT                   /db_xref="GOA:E7BA13"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA13"
FT                   /protein_id="CBY27623.1"
FT                   /translation="MDKLLDRFFNYVSFDTQAKANVKSVPSTEGQRKLALALQHELQML
FT                   GFSQVSLSEHGCVMATLPANVSWLVPTIGFIAHLDTSPDFSGKNVNPQIVENYRGGDIA
FT                   LGMGDEVLSPVMFPVLHQLLGHTLITTDGKTLLGADDKAGIAEIITALVRLKHSNIPHG
FT                   DIRIAFTPDEEVGKGARFFNVAEFNAQWAYTVDGGGVGELEFENFNAASVTIKIVGNNV
FT                   HPGSAKGVMVNALSLATRFHQELPTDETPECTDGYDGFYHLQSIKGTVEWAEMHYIVRD
FT                   FNRDGFEARKKNMVDIAKRVGKGLHRDCYIEIVIDDSYYNMREHIIKHPHIIEIAQQAM
FT                   HDCDITPIMKPIRGGTDGAQLSFLGLPCPNIFTGGYNYHGKHEFITLEGMEKAVAVIMR
FT                   IAELTAKRAKES"
FT   CDS             complement(599543..600664)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27622"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA12"
FT                   /protein_id="CBY27622.1"
FT                   /translation="MDYQLSLDWPDFLQRYWQKRPVILKRGFKHFIDPLSPDELAGLAM
FT                   ENEVDSRLVSHEDGRWQVAHGPFESFDHLGETNWSLLVQAVDHWHEPAAALMRPFRPLS
FT                   DWRMDDLMVSFSVPGGGVGPHFDQYDVFIIQGTGRRRWRVGEKTEMKQHCPHPDLLQVG
FT                   PFDAIIDEEMEPGDILYIPPGFPHEGYALENALNYSVGFRAPNGRELVSGFADYVLARE
FT                   LGSYRYSDPDLQLREHPAEVLPQEVDKLRAMMLDLVQQPEDFQNWFGEFISQSRHELDI
FT                   APPEPPYQAGDIYELLQQGEELQRLTGLRVLRIGDQCFANGELINTPHRQAADALCQHF
FT                   SVDAQKLGDALEDPSFLAMLTALVNNGYWYFSD"
FT   CDS             complement(600746..602110)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05601"
FT                   /product="sensor protein PhoQ"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27621"
FT                   /db_xref="GOA:E7BA11"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR015014"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA11"
FT                   /protein_id="CBY27621.1"
FT                   /translation="MVAVVGYIVSFDKNTFSAHRGESNLFFSLAQWHDNKLSISVPPEL
FT                   ELNIPTLVLIYDKDGNILWRQRHVPELESHIEKSWLQKPGFYELDTGTHISSMMLGDNP
FT                   KAQDQLKKYDDTDNSALTHSVSVNTYPATSRLPQLTIVVVDTIPQELQRSDLVWNWFSY
FT                   VLLANLLLVVPLLWLAAYWSLRPIKALVSQISQLEKGERDQLDENPPRELQSLVRNLNI
FT                   LLTNERQRYTKYRTTLSDLTHSLKTPLAVLQTTLRSLRTGKQTTIEEVEPIMLEQISRI
FT                   SQQIGYYLHRASMRSEHNVLIREIHSVPALLDSLCSALNKVYQRKGVVLTLDISPEVTF
FT                   LGERNDFMEVMGNVLENACKYCLEFVEITALHSEKQLTIVVDDDGPGIPESKRQLIFQR
FT                   GQRVDTLRPGQGLGLSVAAEIIEQYQGKITITESPLGGARMMVTFGQQHDYHADY"
FT   CDS             complement(602209..602880)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05611"
FT                   /product="transcriptional regulatory protein PhoP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27620"
FT                   /db_xref="GOA:E7BA10"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA10"
FT                   /protein_id="CBY27620.1"
FT                   /translation="MRVLVVEDNALLRHHLTVQMREMGHQVDAAEDAKEADYFLQEHAP
FT                   DIAIIDLGLPGEDGLSLIRRWRSHQTNLPILVLTARESWQDKVAVLEAGADDYVTKPFH
FT                   LEEVIARIQALMRRNIGLASQIIEFPPFQIDLSRRELCVNQQQIKLTAFEYTIIETLIR
FT                   NAGKVVSKDTLMLQLYPDAELRESHTIDVLMGRLRKKLLAEHEGEVITTIRGQGYRFDA
FT                   N"
FT   CDS             complement(602952..603575)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05621"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27619"
FT                   /db_xref="GOA:E7BA09"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA09"
FT                   /protein_id="CBY27619.1"
FT                   /translation="MLKQTLLSLALMGTCTAAMAADYTYVAGGLQYGSISNNERFDKEF
FT                   NQSQYSHIGNRDMGGIYFNGSYGFDNDLFIDGRISSIANNDRGLAEAVLGLGYHFAFSP
FT                   NIDFYTLVGGSRHAMVFDASKDGKKTNTYNSATGEIGIKSKLSQDIGLDVAYRMANYDS
FT                   RAYHEARITTDYALTQSLSAEVGYTYHNWKVSDQAMQAGLRYTF"
FT   CDS             complement(603730..605100)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05631"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27618"
FT                   /db_xref="GOA:E7BA08"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA08"
FT                   /protein_id="CBY27618.1"
FT                   /translation="MELSSLTAVSPIDGRYGDKVSALRPIFSEFGLLKFRVQVEVRWLQ
FT                   KLAACAEIKEVPAFDANANAYLDKIVQEFNEQDAQRIKTIERTTNHDVKAVEYFLKEKV
FT                   ESVPALHAVSEFIHFACTSEDINNLSHALMLQTARQDVILPEWRKIIDSIKALAHQYRD
FT                   LPLLSRTHGQPATPSTIGKELANVAYRMERQFRQLSQVEILGKINGAVGNYNAHIVAYP
FT                   EVDWHQFSESFVTSLGINWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDIWGYIAL
FT                   NHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLGHLASKLPVSRWQRDLTDS
FT                   TVLRNLGVGLGYALIAYQATMKGISKLEVNEAHLLEELDHNWEVLAEPIQTVMRRYGIE
FT                   KPYEKLKELTRGKRVDAAGMQAFIDSLALPEAEKNRLKAMTPANYLGRATAMVDELK"
FT   CDS             complement(605126..605752)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05641"
FT                   /product="A protein of unknown function perhaps involved in
FT                   purine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27617"
FT                   /db_xref="GOA:E7BA07"
FT                   /db_xref="InterPro:IPR007451"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA07"
FT                   /protein_id="CBY27617.1"
FT                   /translation="MAKNYYDITLALAGICQSARLVQQLAYEGQCDNDALNTVLSGLLQ
FT                   TNPPSTLAVYGGNEQSLKMGLETLQSVLNANRQGPAAELTRYTLSLMVLERKLNANKSA
FT                   MNTLGDRISQLDRQLAHFDLESETMMSSLAAIYTDVISPLGPRIQVIGSPAILQSTLVQ
FT                   AKIRATLLAGIRSAVLWQQVGGSRLQLMFSRNRLFKQAQSILAHI"
FT   CDS             complement(605883..607004)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05651"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27616"
FT                   /db_xref="GOA:E7BA06"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA06"
FT                   /protein_id="CBY27616.1"
FT                   /translation="MSDNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDD
FT                   GEEYCSAATDLADAQAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCN
FT                   KEIKFKAFLEFAAEDLGADYIATGHYVRRQDVNGKSRLLRGLDGNKDQSYFLYTLSHEQ
FT                   LTQSLFPVGELEKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLPAQPGPI
FT                   MTVDGQHVGEHQGLMYHTLGQRKGLGIGGTKEGGDDPWYVVDKDVANNILLVAQGHEHP
FT                   RLMSVGLIAQQLHWVDREPVTAAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDEPVAA
FT                   VTPGQSAVFYQGEVCLGGGIIEERYPLPGSVAN"
FT   CDS             complement(607190..607636)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05661"
FT                   /product="nudix-like NDP and NTP phosphohydrolase YmfB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27615"
FT                   /db_xref="GOA:E7BA05"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA05"
FT                   /protein_id="CBY27615.1"
FT                   /translation="MFKPHVTVACVVHAQGKFLIVEETINGKKLWNQPAGHLEADETLL
FT                   QAAERELWEETGIRATPQYFLRMHQWIAPDKTPFLRFAFVIELLAPLPTDPHDDDIDRC
FT                   LWLTADEILQSDNLRSPLVAESIRCYQQPERYSLDVISSFNWPL"
FT   CDS             complement(607629..608255)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05671"
FT                   /product="ribosomal large subunit pseudouridine synthase E;
FT                   LSU Psi2457"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27614"
FT                   /db_xref="GOA:E7BA04"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA04"
FT                   /protein_id="CBY27614.1"
FT                   /translation="MNKFSVKNHKVNRFSTKTQAKQVKPITPRRVLLFNKPFDVLPQFT
FT                   DEAGRSTLKEFIPFNDVYAAGRLDRDSEGLLVLTNDGKLQARLTQPAQKTGKVYFVQVE
FT                   GLPDEDALSQLRTGITLKDGPTLPAGAELVSEPAWLWPRHPPIRERKAIPTSWLKITLF
FT                   EGRNRQVRRMTAHIGFPTLRLIRFSIGNLSLGDLQPGEWKEINHV"
FT   CDS             608386..609639
FT                   /transl_table=11
FT                   /locus_tag="Y11_05681"
FT                   /product="isocitrate dehydrogenase [NADP]"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27613"
FT                   /db_xref="GOA:E7BA03"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA03"
FT                   /protein_id="CBY27613.1"
FT                   /translation="MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPA
FT                   MINVVDAAVKKAYNGERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPL
FT                   TTPVGGGIRSLNVALRQQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAG
FT                   IEWKAGSPEAEKVIKFLREEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITND
FT                   RESVTLVHKGNIMKFTEGAFKDWGYQLAREEFGGELFDGGPWVKIKNPNNGKDIIVKDV
FT                   IADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATH
FT                   GTAPKYAGQDKVNPGSIILSAEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLME
FT                   DAKLLKCSEFGDAIIKHM"
FT   CDS             complement(609872..610063)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27612"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA02"
FT                   /protein_id="CBY27612.1"
FT                   /translation="MQCLLAAAAQNIKKMALLGLFCCLLTKYDIHGRAIKWLKIFRALL
FT                   KGVNEWPGKNIAIATFSR"
FT   CDS             complement(610220..610459)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05701"
FT                   /product="transposase for IS1668"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27611"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA01"
FT                   /protein_id="CBY27611.1"
FT                   /translation="MGYRRPNKGQQNVLQKKHFIYDAEQDVYQCPQGQQLIDKTTSREG
FT                   YRHYHSSPEICGQCPRLTGCTKRKNSQKVVTRHV"
FT   CDS             complement(610651..610947)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05711"
FT                   /product="transposase for IS1668"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27610"
FT                   /db_xref="UniProtKB/TrEMBL:E7BA00"
FT                   /protein_id="CBY27610.1"
FT                   /translation="MVTLEGLVSQHHLVRKIDAAIDFEFIRDEVVHLYCHDNGRPAIDP
FT                   VVLFKMMLPGYLVGGRVLYTDSTHLKASATPRKAVLCTGITSRKASSSSTTAQ"
FT   CDS             611319..611801
FT                   /transl_table=11
FT                   /locus_tag="Y11_05721"
FT                   /product="putative prophage terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27609"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z9"
FT                   /protein_id="CBY27609.1"
FT                   /translation="MFFSDSIVEDAQALSLKDELFLSRARNLYMAEKIGLWRSQLDDYG
FT                   GENRDLQDKISAAENAMMRNTARIESIERTLACIRKMCADTDYREVATDKLLREPDRER
FT                   GELELEGLRLRNEKLRTENENLKKSASDNDNELPQPVAININVVDAKVRNDYSADT"
FT   CDS             612208..612333
FT                   /transl_table=11
FT                   /locus_tag="Y11_05731"
FT                   /product="ISsod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27608"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z8"
FT                   /protein_id="CBY27608.1"
FT                   /translation="MNQILADYLGRYANHRQFRKLTKTKGAFPNENSLLKLLYLG"
FT   CDS             complement(612760..613719)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05741"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27607"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z7"
FT                   /protein_id="CBY27607.1"
FT                   /translation="MHKNIYYGAVLSAIIASSTAKADSISLSLSNDDAGIFQPTLDKLY
FT                   SHADGDRDDYSQGLFLGYSRDITDASQLSVYIAHDIYSPSGVNKRPPTAVIGDRAFSAY
FT                   LHTGIEWNSLANDWFRYRLGTDFGVIGPDAGGQKVQNKAHQFINAEKYQAWDDQIENRY
FT                   GYTVKGMLSLTPNIDLWGTNIGVYPELSAVSGNLFQYIGYGATFALGNNKTFNSDNGFG
FT                   LLDRRGLMHTSQKDGLIYKFFAGMERREVDRNYTLQGKTLLTNTETITMNKTVDEYRVG
FT                   ATVGYYPVALTLSLNKVSSEFKTGKDYSYITGAVTFAF"
FT   CDS             614241..614405
FT                   /transl_table=11
FT                   /locus_tag="Y11_05751"
FT                   /product="isocitrate dehydrogenase [NADP]"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27606"
FT                   /db_xref="GOA:E7B9Z6"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z6"
FT                   /protein_id="CBY27606.1"
FT                   /translation="MLRHMGWFEVADLIIKGTEGTIQAKTVTYDFERLMEGAKLLKCSE
FT                   FGDAIIKHM"
FT   CDS             614936..615796
FT                   /transl_table=11
FT                   /locus_tag="Y11_05761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27605"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z5"
FT                   /protein_id="CBY27605.1"
FT                   /translation="MAKDVEIVKARHPLDKQHIKLTYVTHFYCNQGNMDSVESLLKEYE
FT                   SYPDDIKDAVEFVIVDDCSPLEYEVKDYDLNFTWLRITTDIQWNQAGSRNLGVTYAKSD
FT                   KIIITDLDCLLPEDTLRYLVNARNPGRSLYRIYRTDEKTGKAYRGHPNLFFMSRSRFFR
FT                   LYGYDEEFAGHYGSEDYRFVKFHKDHGSTPRYLPKQYRCIERNVDRKKSYHSLDRDLTH
FT                   NAPIDDRKKNEIALFGAEYGHSRIFLNFNWEIKKVHSRPPTVPERKVWWRPLWWFRYLF
FT                   RSLAA"
FT   CDS             615930..617168
FT                   /transl_table=11
FT                   /locus_tag="Y11_05771"
FT                   /product="putative O-antigen biosynthesis protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27604"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z4"
FT                   /protein_id="CBY27604.1"
FT                   /translation="MISSATLPGSPPAHRYIGMFSCTTAFLLGIGLPTSNFIMNLSMVL
FT                   AVICLLLSRDTRYVKALAKNPLIWLPAIMFLLLAISLLWHHNLYGKVMVGKYSKLLYIL
FT                   PLAMFFVLSRSLASYFAKGFLLANAVILAASLWVGVLHMPLGHIDPLNPYVFKLQITHN
FT                   FFMALAAVIWLSLAFSSQGLKRWGYALLVCLAVYNIVFMVQGRTGYVALAAAFGMWGLL
FT                   SLSNRQRLGMVVGALIVVAIVAIVPNRAVERLQQGATEIQSCLAVTHEVNKESCDSSMG
FT                   LRTAFVLESVKLIEQAPVLGHGAGGFRLNYTESEYSINPHNEYLMQTVQSGIIGLVLFL
FT                   GWMWCYFRSALRLPAHLRNILVSLLCAYLACHLFNSFLLDSSEGHLFIILTAIVASFSV
FT                   MPPKERLEMEQTE"
FT   CDS             complement(617242..617418)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27603"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z3"
FT                   /protein_id="CBY27603.1"
FT                   /translation="MLLDKILLVVIMILLSLLAWMFFSPYHMYSTAYEFLELFGFQEGY
FT                   KNLGFGPPTEISD"
FT   CDS             617675..618916
FT                   /transl_table=11
FT                   /locus_tag="Y11_05791"
FT                   /product="sucrose permease, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27602"
FT                   /db_xref="GOA:E7B9Z2"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z2"
FT                   /protein_id="CBY27602.1"
FT                   /translation="MKHSVRNQYLILSGLLFTFFFTWSSAFSLFSIWLNQYVGLKGAET
FT                   GATFSAIAITALCAQPLYGVIQDKLGLKKHLLWAIGILLLISGPFFICVYAPLLRTNML
FT                   AGAVVGGLYMGMTFFAGIGALESYTERVSRISGFEFGKARMWGSLGWAGATFFAGMLFN
FT                   INPNINFWMASASAALFLLLLWRLHEVKADAMGQLEYGKSSALTLHDTLSLLRLSRFWT
FT                   LVVFVTGVSVYNVYDQQFPVYFSSLFADPRHGNEMYGFLNSLQVFLEAGGMFLAPFLVN
FT                   RIGAKKGLLLSGLIMAMRIFGSGLAQDAATISLMKLLHAVELPILLIAMFKYIAANFDP
FT                   RLSATLYLVGFQFVTQVCASIFSPLAGISYDHIGFADTYMVMGAIVLGLTVISCFMLRV
FT                   EPPTDDPSLQLTTK"
FT   CDS             618922..620391
FT                   /transl_table=11
FT                   /locus_tag="Y11_05801"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27601"
FT                   /db_xref="GOA:E7B9Z1"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z1"
FT                   /protein_id="CBY27601.1"
FT                   /translation="MNPLIERANDALQTLASQVGQNFYPHYHLAPLAGWMNDPNGLIFF
FT                   NGQYHAFYQHHPYDENWGPMHWGHATSHDMLSWQHQSIALAPGDLWDKDGCFSGCAVDD
FT                   NGVLSLIYTGHVWLKGEGDDSAIREVQCLATSQDGIHFDKQGVVLNPPVGIMHFRDPKV
FT                   WFEDDCWWMVVGARDERDHGQVLLYRGNSLQQWQFMQVLACADDSMGYMWECPDFFPLG
FT                   NERILMFSPQGLAAKGYLNRNLFQSGVLRGKWQPGADFKPSQPFTELDLGHDFYAPQSL
FT                   LTADGRRVIIGWMDMWQSPMPTKADNWSGCLTLPRELSIDCDGNLLIKAVREVEALRQT
FT                   GEFITSMTLAQEKQLLHENCQSLELQLTWDTTASHAERYGVQLADAQGTGGKVSVYVDN
FT                   QANRLVLDRYYPQYGLTGYRSVALPEQGLLSLRIFIDGSSLEVFINDGQACMSSRIYPT
FT                   EHERCLSLYAENGQAELLHGEYWQLVAKSSR"
FT   CDS             complement(620394..621389)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05811"
FT                   /product="sucrose specific transcriptional regulator
FT                   CscR,LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27600"
FT                   /db_xref="GOA:E7B9Z0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Z0"
FT                   /protein_id="CBY27600.1"
FT                   /translation="MASLKEVANLASVSLMTVSRAINNPDQLRPETYQRVMQAIEALNY
FT                   VPDFSARKMRGNTTKTSTLAVLAWDTATPPFSVEILLSIELTAREFGWNSFLVNLTSHE
FT                   DSERAVNQLLAQRPDGIIFTSMGLRQVTIPERLRDKNIVLANCVSENHSIPSYIPDDFD
FT                   GQYQAMKVLLRRGYQRPLCIYLPECTLAGKARRAGAEKAWQESALPVEQLRQYHLAWGD
FT                   EHYQDVIPLLDRYCPKGKPDFDVLICGNDRIAFLAYQVLLAKGITIPQQVAVVGYDNMV
FT                   GIGELFLPPLTTVQLPHYDIGREAALHLIEGRESRSTHRLSCPLLERASI"
FT   CDS             complement(621520..621780)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27599"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y9"
FT                   /protein_id="CBY27599.1"
FT                   /translation="MSSLNQTSVRAQQGETDANLPGEDHLIAHEALLVALMVECANESD
FT                   NDQFLFSVRETLNGILNSSRYLDASKIANGLLDEADDKANR"
FT   CDS             complement(621953..623512)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05831"
FT                   /product="aerotaxis sensor receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27598"
FT                   /db_xref="GOA:E7B9Y8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y8"
FT                   /protein_id="CBY27598.1"
FT                   /translation="MRVNKPVSRQEYPIGRDTTLQSTTDIKGNITYANAAFVRASGFEY
FT                   QNLLGQPHNMVRHPDMPPAAFADMWQTLNAGLSWSSLVKNRRQNGDYYWVRANATPLRH
FT                   DGRLTGYISVRIAPTREEVKQAEALYGDFNSGKAKQRRIALHRGLIVRTGWLSFRSLFQ
FT                   TLPLRWRLRGALLIAALLPTVAAKGMGISGLPLLGLGATTLFSSLITSLWLERQVSRPI
FT                   AAILQQAQDVSSGQAGDYVQLNRVDEIGYLMRSVNQLGLNLRSLTDDVSGQVDGINTAS
FT                   SEIAAGNRELKVRTEQATANLQHIVSATEQLVATVQNSANSANETTSLAAMSSHAAEQG
FT                   SELMHEVIKTMGTINDSSHRIVDIISVIEGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ASEVRHLAQRSSTAAKEIKHLIETSVERVRDGSALVQNAGATMDNIVKQAGQVSALISE
FT                   ISTSTHEQTQALGQISQSIGQLDQMTHQNAAMVEQYAGAAEELAHRTLRLTAAVRIYRP
FT                   VN"
FT   CDS             complement(624085..625203)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05841"
FT                   /product="error-prone, lesion bypass DNA polymerase V
FT                   (UmuC)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27597"
FT                   /db_xref="GOA:E7B9Y7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y7"
FT                   /protein_id="CBY27597.1"
FT                   /translation="MGAPYFKIQQVMRQHGVTAFSSNYALYSDMSARVMTILEQLAPGI
FT                   EIYSIDEAFLNLKGVQHSIALEEFGRYVRDQIQKLTGLHVGVGIAPSKTLAKLANHAAK
FT                   LWHKTEGVVDLSSPVRQRKLLALMPVAEIWGVGRRTAKKLEMMGITTALQLSEASPPFI
FT                   RKNFSVVLERTVRELRGEACLAVAEFAPTKQQIICSRSFSERITEYQNIREAVCSYAEK
FT                   AAEKLRKEHQYCRHVSTFIKTSPFAPNEIYYSNHASTYLTFPTLDSRDIIAAALKCLRI
FT                   IWRPGHRYLKAGIVLGEFSSQGILQLGLFDESKPHINSEQLMAAIDKINQSGKSKIAFV
FT                   GQGINQEWQMKREMLSPAYTTRVRDCPIATIK"
FT   CDS             complement(625353..625709)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05851"
FT                   /product="error-prone repair protein UmuD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27596"
FT                   /db_xref="GOA:E7B9Y6"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y6"
FT                   /protein_id="CBY27596.1"
FT                   /translation="MSAFGNAAQDYIEKRIDINEHCIVHPAATFFMTAEGESLIEAGIH
FT                   HGALLVIDRSLPAKHGDIVVATIGGEFSIKRLYLRPTPRLEALNAGTPALILCEGDEDL
FT                   VIFGVITFCINKLR"
FT   CDS             complement(626002..626190)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27595"
FT                   /db_xref="GOA:E7B9Y5"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y5"
FT                   /protein_id="CBY27595.1"
FT                   /translation="MPELDIGKSLYGYVDVGVTYKFILFTNRIMTDGMNEAGLNASMLF
FT                   IENTKYQQVGMTASLTL"
FT   CDS             626802..628127
FT                   /transl_table=11
FT                   /locus_tag="Y11_05871"
FT                   /product="O-acetylhomoserine sulfhydrylase;
FT                   O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27594"
FT                   /db_xref="GOA:E7B9Y4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y4"
FT                   /protein_id="CBY27594.1"
FT                   /translation="MRTRSGLDIVILEGMKMKLETLSIHAGYSPDPTTKAVAVPIYQTS
FT                   SFAFDDTQHGADLFDLKVAGNIYSRIMNPTNDVLEQRVAALEGGIAALAVASGMAAITY
FT                   AIQTIAETGDNIVSVAKLYGGTYNLLAHTLPRYGIETRFADHDDIDALEALIDDRTKAV
FT                   FCESIGNPAGNIVDLKKLADAAHRHGVPLIVDNTVATPILCRPFEHGADIVVHSLTKYI
FT                   GGHGSSIGGIVVDSGKFPWAQYPERFAQLNTPDPSYHGVTYTEQFGAAAYIGRCRVVPL
FT                   RNTGAALSPFNAFLILQGLETPALRMERHTENALKVAHYLKNHPQVSWVKYAGLPDHLE
FT                   HDLAQRYLGGKPAAILSFGIHGGQAAGGRFIDALNLIVRLVNIGDAKSLACHPASTTHR
FT                   QLNDEELIKAGVPRDMVRLSIGIEHIDDILNDLAQALDAAKS"
FT   CDS             complement(628190..629047)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05881"
FT                   /product="nadph:quinone oxidoreductase 2; possible
FT                   protective/detoxification role"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27593"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y3"
FT                   /protein_id="CBY27593.1"
FT                   /translation="MIAVTGATGQLGRLVINALLKKVSASEIIAAVRSPEKASDLAALG
FT                   VQVRKADYSQPATLAAAFQGADKLLLISSSEVGQRVAQHAAVINAAKHAGVKLLAYTSL
FT                   LHADKSTLGLGDEHRATEALLRESGLPVVLLRNGWYTENYAASIAPSLDHGAFIGAAGG
FT                   GRIASATREDYAQAAAAVLTQENQAGKIYELAGDDSYTLAEFSAEIARQSGKPVEYKNL
FT                   SEADFKQALIGAGLPEGFASLLADSDAGAAKGGLFDDSHTLSKLIGRPTTPYTKVIAAT
FT                   LATR"
FT   CDS             629317..629721
FT                   /transl_table=11
FT                   /locus_tag="Y11_05891"
FT                   /product="redox-sensing transcriptional regulator QorR"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27592"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y2"
FT                   /protein_id="CBY27592.1"
FT                   /translation="MMKSQNLMGNTAFPEQVRRGELLNANCPSREILKRITSRWGVLVL
FT                   IALSNETLRFSALRRKIGGVSEKMLAQTLQNLEEDGFIERIAYPVVPPHVEYKLTSLGK
FT                   EAQEQVEGLALWLEENLHRIMEKRQQRAAS"
FT   CDS             complement(629785..630069)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27591"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y1"
FT                   /protein_id="CBY27591.1"
FT                   /translation="MFVVSLTYHQPIDVVEALAVSHKDWLKKYYAQGVFIASGRKVPRT
FT                   GGIILAKSIDREELDKILAEDPFNAVAHYEVTEFIPSMTIESVETLKTL"
FT   CDS             630296..630454
FT                   /transl_table=11
FT                   /locus_tag="Y11_05911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27590"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9Y0"
FT                   /protein_id="CBY27590.1"
FT                   /translation="MAKITAWFTGLSWWQPASVSEGDTSLSQADGAHLLETINAIGGLY
FT                   GIEFIHH"
FT   CDS             630665..630871
FT                   /transl_table=11
FT                   /locus_tag="Y11_05921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27589"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X9"
FT                   /protein_id="CBY27589.1"
FT                   /translation="MSKHFSYSKHIIGQAGIVSWGQLSFSHPTLAGLELPYFDIEARQP
FT                   GPKLAIIAGMYPNEVSAWKRLCA"
FT   CDS             631029..631301
FT                   /transl_table=11
FT                   /locus_tag="Y11_05931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27588"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X8"
FT                   /protein_id="CBY27588.1"
FT                   /translation="MLIDSVLNSWAKEAAVFIDLHGGDLGEDVAKFVMCQQIGDDELDN
FT                   IIRSLAPQFDADAIVEFAADQTHNQGWATNELPSLGRHAVMSEGG"
FT   CDS             complement(631371..632285)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05941"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27587"
FT                   /db_xref="GOA:E7B9X7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X7"
FT                   /protein_id="CBY27587.1"
FT                   /translation="MNALLYLLVVLIWGTTWIAITLQQQGSVAITVSIFYRFALAASVM
FT                   MIILLLVRRLRHLALRDHLFCIAQGFCVFAFNFYCFYHAAAYISSGLESVIFSMAVLFN
FT                   AINGMIFFRQRLSPNLLPASILGMIGIIALFWQDLTATQISPELLKGIGLSLLGTYGFS
FT                   LGNMISSRHKRRGLDILSTNAYAMTYGAVLMVFFSLIQHHSFTIELTSSYLGSLLYLAI
FT                   FGSVIAFAAYFSLIGRIGASGAAYSTLLFPLVALTISTFYENYHWHLSAIIGLLLILFG
FT                   NLVMFSKPGMVQSWFKRPSFSDH"
FT   CDS             632284..632430
FT                   /transl_table=11
FT                   /locus_tag="Y11_05951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27586"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X6"
FT                   /protein_id="CBY27586.1"
FT                   /translation="MVISHHLSKHQYLPGGQMHLSEACGKLQNLAHFCDKLLENMVCGT
FT                   ASH"
FT   CDS             632468..633343
FT                   /transl_table=11
FT                   /locus_tag="Y11_05961"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27585"
FT                   /db_xref="GOA:E7B9X5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X5"
FT                   /protein_id="CBY27585.1"
FT                   /translation="MLERYQAFETLREHKARLHDYVQLGSGIQLAAWSNRDDCVTQESP
FT                   DHHTLSLYVADGYECYHKTRAGWKNGGGPDRFCIMPKGSLSSWDVRDDLSFVHLYCTDN
FT                   HLRQLAEQIWERSPQSIQVDERIFAEDPQITLLYRQFLLNYDWQEQANHLALSSAATLL
FT                   MTHLLKTYTQLQWAIPAIRGGLAPVVLKRVKEYIDSHLAQPLLLSDLAAQAGLSEFHFA
FT                   RMFKQSTGLAPHQFVLKARLYRAEQLIRHSLMPLIHIALECGFSSASHFSNCFKVAYGV
FT                   TPSLMRQRKS"
FT   CDS             complement(633367..633789)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05971"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27584"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X4"
FT                   /protein_id="CBY27584.1"
FT                   /translation="MTFSYYYFGVIMRKKKIILATLLILPLSQALAVDCKNAVTQQDMN
FT                   QCANSDYKKADAELNRTYKDLLAKTTVAQRPLLKSAQLIWIKYRDADCTFQSSATEGGS
FT                   VHPMIISACLTHKTEERTTQLKSFLNCSEGDLSCPL"
FT   CDS             complement(633835..634146)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05981"
FT                   /product="protein hdeB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27583"
FT                   /db_xref="GOA:E7B9X3"
FT                   /db_xref="InterPro:IPR010486"
FT                   /db_xref="InterPro:IPR028623"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X3"
FT                   /protein_id="CBY27583.1"
FT                   /translation="MVYKSLSSIAIATLLVTTMAPVFASSTTPKDMTCKEFLDLNPKSM
FT                   TPVAFWILNEDTQYKKGDNVDFQEVDTVYTPKVIDICKKSPDKKISDMKPDIMTAAKK"
FT   CDS             complement(634417..634674)
FT                   /transl_table=11
FT                   /locus_tag="Y11_05991"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_05991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27582"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X2"
FT                   /protein_id="CBY27582.1"
FT                   /translation="MKTLLIIYMFTVLLFNMTTSYAAPPAHKEMQKSPGENCKRPPEPP
FT                   KDKNGPHCPPKDHNNSHVSKGQPPYDDKHLCPPPQGNKKP"
FT   CDS             634930..636333
FT                   /transl_table=11
FT                   /locus_tag="Y11_06001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27581"
FT                   /db_xref="GOA:E7B9X1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X1"
FT                   /protein_id="CBY27581.1"
FT                   /translation="MSLFSFYHSCLDFLSRKVFGKHSKGEPVKRENGKHELSTLQLDVL
FT                   LNAEKQIAIITTDLDNCITIYNVGAEKMFGYSKDEVLGKPISNILYIPEKGEFQVDLDY
FT                   LLLNRREANEWCYQRKDGKRFWGTLSVHEITSDNGHIMGYISVIADVSERKSLLIELEK
FT                   SKQMMDKLTKNLPAMIYAYYLNSDGESYFSYCSEGIRKIFDLAPADVLRVPQEKNPLFS
FT                   RIHTDDREMLKQAVTTSQQNLSVWRCDFRVELPGKGTHWLHGESFPTRKDDGSVIWYGS
FT                   FFDITELKQSESILKALAQTDVLTGVANRRHFDDIYQHIWQKTQTEGGTLSVLMIDFDN
FT                   FKNFNDLYGHAMGDVCLKSIVETLAKSIRGGSDILARYGGEEFIVLLAPSNLTDATAVA
FT                   ERMRHSIEELDIPHGMSPHGRVTISVGVASVSDPGKYLSAKDLSDAADKALYRAKTAGK
FT                   NQVKALELD"
FT   CDS             637019..637972
FT                   /transl_table=11
FT                   /locus_tag="Y11_06011"
FT                   /product="cytolethal distending toxin subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27580"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9X0"
FT                   /protein_id="CBY27580.1"
FT                   /translation="MNGLLKIIFYSLSSLCLVAEANVIDYKLASWNMQGAQSGSGSNSK
FT                   WIAGVTGMFTRNGMDIVALQETGAVPTTANSLPVIAGQHPEIERRIPHADRQVPMTSLD
FT                   GGVATPINPGQQGVIKDKVREYLWNLGSSRRASDVYIYHFDFGRQNAASRINIAIASRI
FT                   RADEVIIVPPMTSGNNARPTLGIRIGNDYFFSLHAEASGSHGNNEAPQIVQFINNYMTQ
FT                   TVQAARPDATWIVMGDYNRSPSELANSLTALNLPPQSYEIVAPNQATQQSNNILDYAVM
FT                   GNVNRGRLGMGGLAVQMLASLMGQLSDHIGVMYRLR"
FT   CDS             complement(638098..638946)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27579"
FT                   /db_xref="GOA:E7B9W9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W9"
FT                   /protein_id="CBY27579.1"
FT                   /translation="MKIPKRIQPLVDDGLVDEVIRRLKSGKEADVYVVRCGQDIRCAKV
FT                   YKEAENRNFKQAVQYQEGRKVRNSRDARAMAKGSKFGRKQQEETWQTAEVDALYLLANA
FT                   GVRVPQPYACLDGVLLMELVTDEDGLAAPRLSDVPFSKEQALIDHAIMIRYVVRMLCAG
FT                   LVHGDLSEFNVLIDKDGPVIIDLPQAVNAAANNHAKAMLERDVANMTHYYGQYAPELLG
FT                   TKYAKEMWALYEDGKLHPETPLTGEFAESTQAADVEGVLEEIQAVIAEEQERLREAQDP
FT                   Y"
FT   CDS             complement(639049..640767)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06031"
FT                   /product="lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27578"
FT                   /db_xref="GOA:E7B9W8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W8"
FT                   /protein_id="CBY27578.1"
FT                   /translation="MLRRFFSYYTPYKGLFYLDFGCAILAGLLELSFPMAVKLFIDKLL
FT                   PNQDWVLIVWAATGLLMIYLLNTALMAIVNYWGHALGVGIETDMRRQAFSHLQKLSFSY
FT                   YDNMKTGHIITHVTKDLEEVGEIAHHGPEDLFIAVMTFIGAFILMASVHLPLAMLTIVI
FT                   VPFMTYLVSRYGAQMTDTWRRLFGQVGNFNARIEESIGGIRVVKAFANESHEKKLFARD
FT                   NEDYRTTKLKAYRIMTTSMTMSYLSTRLVQLIVMVVGTWYVVHDQLSYGGFVGFLLLVE
FT                   VFFRPVAKITSVLESYPKGIAGFKRFTQLIDTLPDIVDQPNARPVGHLKGDICYQDVSF
FT                   GYSPQSKIFTHLNLQIRAGETVAFVGPSGAGKTTLCSLLPRFYELDGGVITIDGINIRD
FT                   MTQQSLRNNIGIVQQDVFLFGGSIRENIAYGKLDASDDEIMAAARQARLDELIESLPDG
FT                   LDTVVGERGVKLSGGQKQRLSIARIFLKNPPILILDEATSALDTATEQAIQLALTELSQ
FT                   GRTTLVIAHRLATIQNADRIIVVDKEGIVEQGDHHELLARNGAYAKLHNAQFSAA"
FT   CDS             640967..641386
FT                   /transl_table=11
FT                   /locus_tag="Y11_06041"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27577"
FT                   /db_xref="GOA:E7B9W7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W7"
FT                   /protein_id="CBY27577.1"
FT                   /translation="MKLTMTDTPTTEDVAEIMAGLKAFNRNFVGDNGRKPLAVFITDEH
FT                   GEKLGGITAYTLGHYLSIELLWISDTLRHCGAGSKLMQAVEQEAIQRGCKFAQVDTFSF
FT                   QARPFYEKLGYQLQMTLENVVDEYHRYYLTKSLMS"
FT   CDS             complement(641455..641568)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27576"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W6"
FT                   /protein_id="CBY27576.1"
FT                   /translation="MSFHQKLNIHRLSIASINNARSHRENGAVHWCIAELS"
FT   CDS             641654..643156
FT                   /transl_table=11
FT                   /locus_tag="Y11_06061"
FT                   /product="arginine/ornithine antiporter ArcD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27575"
FT                   /db_xref="GOA:E7B9W5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W5"
FT                   /protein_id="CBY27575.1"
FT                   /translation="MAASSNKKLSLWSLTSLVVGSMIGAGIFSLPATFGRATGGFGALI
FT                   AWVIAGGGMLTLAFVFQTLAQRKPELDSGVYIYAKTGFGDYAGFASAIGFWAGACIGSV
FT                   SYFVLIKSTLGAFFPLFGDGNTLSAVLIASFILWSFHFMVLRGIKEAAAINTIATFAKV
FT                   IPIFIFIIVLAFAFHTDTFALNFWGIQPLGAVGDLTHLDDYGYTGHAALEIGSGSESLF
FT                   SQVRSTMLVTVFVFVGIEGASVYSRYAKERKHVGIATVLGFIGVLCLLVLVTMLSYGVL
FT                   LRPDLAALRQPSMAGVLEHIVGRWGAIFISIGLIISVMGAYLSWTLLAAEALYCAAKSN
FT                   IMPSVLATENKHGVPSAAVWMSNIFIQLFLIVTLFTEYAFQLALELTSSLVLIPYLLVA
FT                   AYGLKLAWTRETYTVGAKDHKKDFIIASIATFYAVLMVYAGGLKYILLSAVIYGPGTLL
FT                   FIIAKREQKKLVFSAIEKCAFAVALIAAVAALYSLATGIITV"
FT   CDS             643592..643756
FT                   /transl_table=11
FT                   /locus_tag="Y11_06071"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27574"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W4"
FT                   /protein_id="CBY27574.1"
FT                   /translation="MDKSLFDDNKVIALIGLLLAALIVVSTMFVMTYMADRQRNEIQTV
FT                   DVQNCYKKN"
FT   CDS             complement(643815..644081)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06081"
FT                   /product="regulatory protein soxS"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27573"
FT                   /db_xref="GOA:E7B9W3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W3"
FT                   /protein_id="CBY27573.1"
FT                   /translation="MQKIFKEVTGVSLGKYIRERRLAGAVYQLRSSDSTIFDIALDFGF
FT                   GSQSHFTYMFRKRYGITPYDFRQNTDIDLNIALPLHTTHQKLA"
FT   CDS             644440..644553
FT                   /transl_table=11
FT                   /locus_tag="Y11_06091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27572"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W2"
FT                   /protein_id="CBY27572.1"
FT                   /translation="MLITVIMTLIAVVGVTVFLKMPVMVLHKDKSVGGDKL"
FT   CDS             644869..645108
FT                   /transl_table=11
FT                   /locus_tag="Y11_06101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27571"
FT                   /db_xref="InterPro:IPR020262"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W1"
FT                   /protein_id="CBY27571.1"
FT                   /translation="MSEMFTNDQELVSDLVACQLVIKQILDVIDIIAPTEVRDKMSHQL
FT                   KAIDFASHPAGADPVTKRAIEKAIALIDMKFTRK"
FT   CDS             complement(645201..645434)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06111"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27570"
FT                   /db_xref="InterPro:IPR025611"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9W0"
FT                   /protein_id="CBY27570.1"
FT                   /translation="MSLFRLLLVVAIIYLGLLFSGYGVLIGSEKNAAGIGLQCKYLTAR
FT                   GISTAQFINGENGIIGVSNCPLVKKIGNNVFE"
FT   CDS             645680..645823
FT                   /transl_table=11
FT                   /locus_tag="Y11_06121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27569"
FT                   /db_xref="GOA:E7B9V9"
FT                   /db_xref="InterPro:IPR020907"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V9"
FT                   /protein_id="CBY27569.1"
FT                   /translation="MNIKKLVATVGIIAVCCLFYLLALDSYCDQGGTFSTGMCTITSII
FT                   PW"
FT   CDS             645973..646248
FT                   /transl_table=11
FT                   /locus_tag="Y11_06131"
FT                   /product="putative exported protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27568"
FT                   /db_xref="InterPro:IPR025594"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V8"
FT                   /protein_id="CBY27568.1"
FT                   /translation="MLDTNMGTMGIVPIAFSLFTVIFFLIVWFFLSRTSVRANEQIRLL
FT                   QDIVEQQKQQTELLKALLANATGTSDFQSDSDIVSPLDFKGVIPER"
FT   CDS             646450..646749
FT                   /transl_table=11
FT                   /locus_tag="Y11_06141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27567"
FT                   /db_xref="InterPro:IPR019701"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V7"
FT                   /protein_id="CBY27567.1"
FT                   /translation="MIKWYEESDSEVNRSIALLSGEDPDKWYPYGGIKGKDYCKNPSDA
FT                   WPIIYANKIGLYSPEINDNNQWNARITNPQGEWQAYSQSPLRAAMICYLLSQEV"
FT   CDS             646832..647101
FT                   /transl_table=11
FT                   /locus_tag="Y11_06151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27566"
FT                   /db_xref="InterPro:IPR025135"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V6"
FT                   /protein_id="CBY27566.1"
FT                   /translation="MIAFVELMMKRIIKGDSNLSHLVIAHAAIDHHQKSYGERRQGWPS
FT                   TYLIRYKNNRVAVEVVTRRQSYVATLMIGARNLSKLCGISALHL"
FT   CDS             647293..648684
FT                   /transl_table=11
FT                   /locus_tag="Y11_06161"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27565"
FT                   /db_xref="GOA:E7B9V5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V5"
FT                   /protein_id="CBY27565.1"
FT                   /translation="MEQQLQDSTLKRGLKNRHIQLIALGGAIGTGLFLGIAQTIKMAGP
FT                   SVILGYAIGGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGDFAGFLSGWNYWAMFIL
FT                   VGMAELTAVGIYIQYWWPEIPTWVSAAIFFVLINAINLVNVRMYGETEFWFAIIKVVAI
FT                   IGMIVFGAYLLASGSGGPNASVTNLWAQGGFMPHGFSGLVMAMAVIMFSFGGLEMVGIT
FT                   AAEAEDPHHSIPKATNQVVYRILIFYIDSLAVLLSLYPWGKVVEGGSPFVMIFHALDSN
FT                   LVATILNVVVLTAALSVYNSGVYCNSRMLFGLASQGNAPKVLTNVNKRGVPILSIALSA
FT                   LATSAGVVINYVMPGKAFELLMALVVSTLVINWVMICLAHLKFRAAKVREGVEPRFKAL
FT                   WYPYGNYLCLVFLMLILVIMYLTDGIQISVLMMPAWIALLWCGFMLTRRKSKNSQPKLK
FT                   DSSAV"
FT   CDS             complement(648925..649539)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06171"
FT                   /product="lipid A acylation protein
FT                   PagP,palmitoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27564"
FT                   /db_xref="GOA:E7B9V4"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V4"
FT                   /protein_id="CBY27564.1"
FT                   /translation="MSYKHLISACIFSSLCLGQVNAVLAEDKLPPSNASTGQQSELSVD
FT                   NDNLWQRLLRNISLAWDSPNQELYIPLNTWHNRWTYDDDKIESYNERPWGIGYGKYRYD
FT                   ENNNWHAVYAMAFMDSHNEVEPIIGYGYQKMWIPGEMDGWRFGVGFTASITARHEYHYI
FT                   PIPLPLPLISIEYNKFALQTTYIPGTYNNGNVLFTWMRWQF"
FT   CDS             650537..650653
FT                   /transl_table=11
FT                   /locus_tag="Y11_06181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27563"
FT                   /db_xref="InterPro:IPR019672"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V3"
FT                   /protein_id="CBY27563.1"
FT                   /translation="MCGIFSKEVLSKDVSVEYRFSADPYLSASSSNDSSLSM"
FT   CDS             complement(650983..651702)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06191"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27562"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V2"
FT                   /protein_id="CBY27562.1"
FT                   /translation="MTDFSPHLSRITTICYGFGNKSALLPDCLQSYQASQANKKQVHGT
FT                   TIVDVITPGQECGEADGLYTTQSGILLTVLTADCLPMIFSQRDGKGIAVVHAGWRGLLD
FT                   GIILRMVERIARDDNPANWVAAIGPAARSCCYEVNEELVERFINELPLAKNIISPRFRH
FT                   LNLAAIAEHQLRGVGIHQIDRVGSCTICTTTPDDGDNTQPRFKYTSFRRTSQQQAIDPS
FT                   HPGIKGRNQYSGLIILP"
FT   CDS             651904..652737
FT                   /transl_table=11
FT                   /locus_tag="Y11_06201"
FT                   /product="cell division protein FtsI [Peptidoglycan
FT                   synthetase]"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27561"
FT                   /db_xref="GOA:E7B9V1"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V1"
FT                   /protein_id="CBY27561.1"
FT                   /translation="MISKPKNDSFSFIRWRFSLLCGCILLSFVGLIARVAWLQIIEPDP
FT                   LVKEEDMRSVRVVATPNTRGMITDRNGHLLAVSVPVEAIWADPATVLEKGGVGVSERWQ
FT                   ALAQELNIPLDQLNSRIRQNPHARFIYLARQVEPDVVEYVQRLKLPGIAIKEESRRFYP
FT                   SGDIAANLVGFTNIDDQGIEGVEKSFNALLSGTAGSRVVRKDRFGRVVEDISSTDSHPG
FT                   QNVQLSIDERLQAEASHALTNAVIFNKADSGSAVVIDVNTGEVLAMANYPTFQPQ"
FT   CDS             652817..653614
FT                   /transl_table=11
FT                   /locus_tag="Y11_06211"
FT                   /product="cell division protein FtsI [Peptidoglycan
FT                   synthetase]"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27560"
FT                   /db_xref="GOA:E7B9V0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9V0"
FT                   /protein_id="CBY27560.1"
FT                   /translation="MVVMTALERHIVKPDAVLDTHPYILSGHLIKDVALYPALSLTGVL
FT                   QKSSDVGVSRLALAMPASALMQTYSAFGLGKPTQLGLTGESSGLMPHRQRWSDLDRATF
FT                   SFGYGLMVAPLQLARVYATIGSFGIYRPLSITKVDPPVLGQRIFPEELVRQVEHMMESV
FT                   ALPGGGGVKAAVRGYRVAVKTGTAKKIGPNGQYIDKYVAYTAGVAPASQPRFALVVVIN
FT                   NPQGGKYYGGAVSAPVFSDIMGQILRTMNVEPDAIPVNVIRHS"
FT   CDS             653732..654592
FT                   /transl_table=11
FT                   /locus_tag="Y11_06221"
FT                   /product="ribosomal RNA large subunit methyltransferase A"
FT                   /EC_number="2.1.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27559"
FT                   /db_xref="GOA:E7B9U9"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U9"
FT                   /protein_id="CBY27559.1"
FT                   /translation="MSYQCPLCHQALQQSPQQWRCSNNHQFDCAKEGYVNLMPVQHKGS
FT                   KQPGDSPEMMQARRAFLDAGYYQPLQQQVCDILDKALPQDAAMLLDIGCGEGYYTAAVA
FT                   DRLNRQRQMAIFGLDVAKVAVRYGAKRYPQVSFCVASSHRLPFANHALDAVLRIYAPCK
FT                   ATELARTVKPGGIVVTVAPGPRHLYQLKALIYAQVQLHDDTPEHLDGFDLISSENLAFE
FT                   IKLTGKQSFNLLQMTPFAWRASIETGQELAARQSFVCETDFVIAVHRRREDLASTALSS
FT                   DEKLI"
FT   CDS             complement(654754..655032)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27558"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U8"
FT                   /protein_id="CBY27558.1"
FT                   /translation="MPYFTVSIVLHNAVEGDYDSLNKKMIDAGFTCLIGREKVYKLPEG
FT                   EFNYGSGTLNKQEVADLALKVAEQIRFIPSILVTESGGRTWRNLDLK"
FT   CDS             complement(655200..657281)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27557"
FT                   /db_xref="GOA:E7B9U7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U7"
FT                   /protein_id="CBY27557.1"
FT                   /translation="MALHPASFDDHIFRLLIEAVDDYAIYIIDAQGHILTWNNGAERNT
FT                   GYNADEIIGQSFELFYPPEDLATQLPAKGLLHANQLGHYENQGWRVRKNGKRFWGHITL
FT                   SALHDSDHNLQGFVQITRDLTDKWLRENALRKSEELFRHLISEVEDYAIYMIDTHGRIL
FT                   TWNKGGERNEGYTSDEIIGEHFALLFTPEDISAGLPEKSLAKAIAEGNFQTEGWHVRKN
FT                   GIRYWASVAINPMHDDSGKLLGFTKIVRDLTERRQREEALRISEERFRLMVDTVEDYAI
FT                   VMLDPWGRVNTWNHGAERNMGYASNEIIGQHFGGFFLPEDIAAGLPEKLLKTSASASRV
FT                   EREGWLVRKDMTRYWAVAIITVIHDNSGKLLGYAKIIRDMSERKQREDALRASEIARYE
FT                   EREQLHRVLSSIQEGIISLDTEGRVVLMNPKAEEMTGRSQNESCGLPIEEVFILWSPLQ
FT                   DKNQLVAINQCLAEGRHTLLPEGSQLLSSQGERQEIRCSASPIRDRDNLLTGAVVVFQD
FT                   VTRARHEQRELQYQANHDMLTGLINRRRLEERLNQAISQLGQDEQHILCYVDLDYFKDV
FT                   NDSAGHEAGDMVLRMVAQTMQQAVRENDIVARLGGDEFAIVLFNCQHKPATEVLERVVA
FT                   DIASIQFHWHGQSYSFTASLGAVSLNRQTETAAQAMRQADIACYAAKHAGRNRLSLSL"
FT   CDS             657866..660145
FT                   /transl_table=11
FT                   /locus_tag="Y11_06251"
FT                   /product="ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27556"
FT                   /db_xref="GOA:E7B9U6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U6"
FT                   /protein_id="CBY27556.1"
FT                   /translation="MNQIISSRVHQKRLVPRLLCVMIGAALGTLSASSWAAAATDSTAE
FT                   NAKKTSAIAATAKTEDNKTNDTITVVGAQETFRAGGNDLIPTYLDGQVANGGRIGFLGQ
FT                   QDARNVPFNVISYTSKMIEDQQANSIADVVKNDASVQNVRGYGNPSQNYRIRGYNLDGD
FT                   DISFGGLFGVLPRQIVSTSMVERVEVFKGANAFINGISPSGSGVGGMINLEPKRAGDTP
FT                   LTRVTVDYGSASQVGGALDVGRRYGDDDQFGVRVNVLHREGESAIHDQKERTTAVSTGL
FT                   DYRGDRARTSLDVGYQKQTIHHMRTDVAIGGATVIPEPPSSTLNYGQSWVYTDMETTFG
FT                   MLRSEYDVSQNWTIYGSVGASRNEETGQYGSPTLTSANNGDATISRLYVPYVADSVAGL
FT                   GGIRGHFDTGPITHKVNLGYAANYRTAKSAWNMSNPVDTNIYNPGVIDFPATTMGSTSQ
FT                   DPQLNSQVRASGLSLSDTLSMMDDKVSLMLGVRRQEVTIRNFDSGVPNSAGSLDAMKVT
FT                   PIYGIMVKPWEKVSLYANHIEALGPGKSAPYQFNGKPVVNAGQIPGIIHSKQNEIGVKF
FT                   DNQRYGGTLALFEITRPTGMVDPATNVYGFYGEQRNRGIELNVFGEPVFGTRLLASATW
FT                   LDPKLTKAADSANNGNDAVGVANYQLVFGGEYDIPVVEGLTATGTVVRSGSQYANEANT
FT                   LKLKPWTRLDLGVRYTMPMKDTSLTWRANIENVTNERYWESVEDSGTYIYQGDPRALKL
FT                   SVSMDF"
FT   CDS             complement(660475..661044)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06261"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27555"
FT                   /db_xref="GOA:E7B9U5"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U5"
FT                   /protein_id="CBY27555.1"
FT                   /translation="MNLSATLVLAFAMSMDAFAASIGKGASLHKPRFREAIRTGLIFGV
FT                   IEAITPLIGWCIGLFASQYILEWDHWIAFSLLFILGCRMIFEGAKQQVEETEKMRSHSF
FT                   WVLVMTAIATSLDAMAIGVGLAFLQVNIVHTAMAIGLATMIMATLGMLIGRYIGPLLGK
FT                   RAEIIGGIVLIGIGFNILYEHIYRLA"
FT   CDS             complement(661485..661946)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27554"
FT                   /db_xref="GOA:E7B9U4"
FT                   /db_xref="InterPro:IPR009328"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U4"
FT                   /protein_id="CBY27554.1"
FT                   /translation="MSVTDIVLIVFIALLLAYAIYDEFIMNMMKGKTRLQIQLKRKSKI
FT                   DCAIFVGLIAILVYNNVMANGEPLTTYLLVGLALIAFYLSYIRWPKLLFKNTGFFYANA
FT                   FIEYRRIKSMNLSEDGILVIDLEQRRLLIQVRQLDDLEKIYNFFVENQS"
FT   CDS             complement(662010..662873)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06281"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27553"
FT                   /db_xref="GOA:E7B9U3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="InterPro:IPR018405"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U3"
FT                   /protein_id="CBY27553.1"
FT                   /translation="MVDTTTVDKTTTGEKKLTPADIRGVFIRSNLFQGSWNFERMQALG
FT                   FCFSMVPAIRRLYPENSEERKQAIKRHLEFFNTQPFVAAPILGVTLAMEEQKANGAEID
FT                   DAAINGIKVGLMGPLAGVGDPIFWGTVRPVLAALGAGIAMSGSLLGPLLFFVLFNLVRL
FT                   LTRYYGVAYGYSKGVNIVSDMDGGLLQKLTEGASILGLFVMGALVNKWTHVNIPVVVSK
FT                   ITNPAGETTVTTVQTILDQLMPGLVPLLLTFGCMWLLRRKVNALWIIMGFFAIGIFGYW
FT                   IGFLAP"
FT   CDS             complement(662889..663686)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06291"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27552"
FT                   /db_xref="GOA:E7B9U2"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="InterPro:IPR018404"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U2"
FT                   /protein_id="CBY27552.1"
FT                   /translation="MEITTLQIVLIFIVACIAGMGSILDEFQFHRPLVACTLVGLVLGD
FT                   MKTGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTILVIAGGQDIGAGIALAIPLAA
FT                   AGQVLTIIVRTITVAFQHAADGAAERGSLRAITWIHISALFLQAMRIAIPALIVALSVG
FT                   TSEVQMLLSSIPDVVTSGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNF
FT                   NLVALGVIGVVMALLYIQLSPKYNKSQVVQSGPSNNDLDNELD"
FT   CDS             complement(663904..664869)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06301"
FT                   /product="PTS system, mannose-specific IIA component; PTS
FT                   system, mannose-specific IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27551"
FT                   /db_xref="GOA:E7B9U1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U1"
FT                   /protein_id="CBY27551.1"
FT                   /translation="MSIAIIIGTHGVAAEQLLKTTEMLIGEQENVAYIDFVPGENADTL
FT                   VEKYTAKLEGLETSAGVIFLVDTWGGSPFNAASRIVTDKENYEVIAGVNIPMLVETFMA
FT                   RDDNPSFAELVGIALETGRAGVKALKTSQVEPETKPAAVRKVATAPAVALGPDDHMKIG
FT                   LARIDDRLIHGQVATRWTKETNVNRIIVVSDEVAADKMRSTLLKQVAPPGVTAHVVDVE
FT                   KAIRVYNNPQYAKDRVMLLFTNPTDVVRLVEGGVDIKSVNIGGMAFRQGKTQVNNAVSV
FT                   DEKDVEAFKKLNARGIELEVRKVSSDSRIKMMDLISKLDK"
FT   CDS             665278..665415
FT                   /transl_table=11
FT                   /locus_tag="Y11_06311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27550"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9U0"
FT                   /protein_id="CBY27550.1"
FT                   /translation="MKISMLFTEALNLTRLRFIAGRVINLTMLIKKFLIKLTALLIVRS
FT                   "
FT   CDS             665651..667183
FT                   /transl_table=11
FT                   /locus_tag="Y11_06321"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27549"
FT                   /db_xref="GOA:E7B9T9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T9"
FT                   /protein_id="CBY27549.1"
FT                   /translation="MDPSIWAGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARII
FT                   GLSLALIMRLGLLSVISWMVTLTTPLFSVGSFSFSGRDLILLVGGLFLLFKATTELHER
FT                   LEGNQHDDSASKGYASFWAVVAQIVVLDAVFSLDAVITAVGMVNDLAIMMTAVVIAMGV
FT                   MLLASKTLTRFVNAHPTVVVLCLSFLLMIGLSLIAEGFGFHIPKGYLYAAIGFSILIEL
FT                   FNQIARRNFIKHESRLPRRQRTAEAIIRLMGGRQQQEPQNGDPQLAMPAEAFAEEERYM
FT                   ISGVLTLASRSLRSVMTPRTEISWVDCHRSQAEIREQLLDTPHSLFPVCRDSLDQIVGV
FT                   VRAKDLLVAIERGDSICEFAAETPPIVVPDTMDVINLLAVLRKAKGRLVVVNDEFGVVQ
FT                   GLVTPLDVLEAIAGEFPDEDETPDIIADGDGWLVKGGADLHSLEQALDCQELVSPTADY
FT                   ASLAGMLLSHSGHMPTAGDVVELHNLRFEIIEVSDYRIELVRITKLSDELEV"
FT   CDS             667635..667754
FT                   /transl_table=11
FT                   /locus_tag="Y11_06331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27548"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T8"
FT                   /protein_id="CBY27548.1"
FT                   /translation="MRGRPQKQFNYWILFIFKLKNSFSVIDTTASIFLYPFYK"
FT   CDS             complement(668286..669650)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06341"
FT                   /product="L-serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27547"
FT                   /db_xref="GOA:E7B9T7"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T7"
FT                   /protein_id="CBY27547.1"
FT                   /translation="MISVFDMFKIGIGPSSSHTVGPMKAGKEFADLLVTQGLMPSVTRV
FT                   AVDVYGSLSLTGKGHHTDIAIIMGLAGNMPDTVDIDSIPAFIRDVELRQKLMLANGLHE
FT                   VHFPREGGMVFRSDNLPLHENGMQIHAFAGDEKVLSKTYYSIGGGFIVDEEHFGKAAVN
FT                   AVSVPYPFHSAEEILANCEQTGMSISGMVMQNELAMHSKEEIESYFTAIWQTMRACIDR
FT                   GLNTEGVLPGPLRVPRRASALRRMLVSSDKLSSDPMNVIDWVNMFALAVNEENAAGGRV
FT                   VTAPTNGACGIVPAVLAYYDHFIEPVTPEIFIRYFLSSGAVGILYKMNASISGAEVGCQ
FT                   GEVGVACSMAAAGLAELLGASPVQVCIAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIA
FT                   SVKAINSARMAMRRTSEPRVSLDKVIETMFETGKDMNAKYRETSRGGLAIKVQCD"
FT   CDS             complement(669949..670074)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27546"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T6"
FT                   /protein_id="CBY27546.1"
FT                   /translation="MSDQLHSLKAKKAELQHKAISITPLHRFLLYFPRTTILKKL"
FT   CDS             complement(670103..670690)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06361"
FT                   /product="hypothetical nudix hydrolase YeaB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27545"
FT                   /db_xref="GOA:E7B9T5"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023735"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T5"
FT                   /protein_id="CBY27545.1"
FT                   /translation="MSDQFVSQSGQTLSEFISRFQLQQPQPGSFSANSHHAAILIPIVC
FT                   RPEPTLLLTRRSDHLRKHAGQVAFPGGKADPQDSSLIETALREAEEEVAIPVSAVHVLG
FT                   QLAPLDSSSGFQVTPIVGLVPDNITFHGNEEEVAGLFEIPLYEALRLSRYYWLDIHRGG
FT                   VNHRVYLSWYESQFIWGLTAAIIRRLAQQVNI"
FT   CDS             complement(670703..672073)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06371"
FT                   /product="para-aminobenzoate synthase, aminase component"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27544"
FT                   /db_xref="GOA:E7B9T4"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T4"
FT                   /protein_id="CBY27544.1"
FT                   /translation="MSVKSLTFKTLPYQPDALIQQFAPLAHQTWAMLLHSGFAEHTHNR
FT                   FDILVADPRVTLTTRGEQTEIISAQGQEFSSEDPFSLLQQQLDQFLRPRSPHPDLPFLG
FT                   GALGLFGYDLGRRVEVLPALAEQDITLPDMAVGLYDWALIADHHLQKLTLVCHGDAEQR
FT                   LCWLQQQKCAAATQPFKLTSQWQANMSREQYGEKFRQIQEYLHSGDCYQINLTQRFSAE
FT                   YQGDEWQAFLSLSRSNRAPFSAFIRLPQNTILSVSPERFLWLENHRIQTRPIKGTLPRL
FT                   DDPEQDKLQAERLANSEKDRAENLMIVDLLRNDIGRVAQAGTVRVSELFVVEPFPAVHH
FT                   LVSTITANLPAESSATALLRACFPGGSITGAPKIRAMEIIEQLEPQRRNAYCGSIGYIS
FT                   CCGTMDTNITIRTLLTENGKIYCSAGGGIVADSQEQAEYQETFDKIARILPLLEDDE"
FT   CDS             672256..672513
FT                   /transl_table=11
FT                   /locus_tag="Y11_06381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27543"
FT                   /db_xref="InterPro:IPR005371"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T3"
FT                   /protein_id="CBY27543.1"
FT                   /translation="MLAGMPSLSHEEQQEAVERIHQFMSEGMSSGEAIALVAAEIRERH
FT                   QNDPQAMAIFEDTDFDEHDESDYRRDNEQDADEIEDPYEG"
FT   CDS             complement(672581..673762)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06391"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27542"
FT                   /db_xref="GOA:E7B9T2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T2"
FT                   /protein_id="CBY27542.1"
FT                   /translation="MLTIGTALRPNATRVMLLGSGELGKEVAIECQRLGLEVIAVDRYA
FT                   DAPAMHVAHRSHVINMLDGAALKQLVAQEKPHYIVPEIEAIATDMLVELENMGQKVVPC
FT                   AEATRLTMNREGIRRLAAETLQLPTSSYRFADTESAFRQAVSEMGYPCIVKPVMSSSGK
FT                   GQSLIRNEPQLQAAWDYAQQGGRAGGGKVIVEGLIHFDFEITLLTISAVDGIHFCAPIG
FT                   HRQEDGDYRESWQPQAMSDVAVARAKEIASQVVKALGGYGLFGVELFVCGDEVIFSEVS
FT                   PRPHDTGMVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSHNIAYHGL
FT                   ETALVSDTQIRLFGKPDIAGKRRLGVALAVADDTDTATEVAKRAASAVVVTGK"
FT   CDS             674016..675398
FT                   /transl_table=11
FT                   /locus_tag="Y11_06401"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27541"
FT                   /db_xref="GOA:E7B9T1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028619"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9T1"
FT                   /protein_id="CBY27541.1"
FT                   /translation="MSTTSFSSLTLPAEQLSNLNELGYTEMTPVQAAALPAILNGQDVR
FT                   AKAKTGSGKTAAFGIGLLDKIAVGEFVTQALVLCPTRELADQVSKELRRLARFTQNIKI
FT                   LTLCGGQPMGHQLDSLVHAPHIVVGTPGRIQEHLRKKTLVLDDLKILVLDEADRMLDMG
FT                   FTDAIDDVIAYTPPQRQTLLFSATYPAGIEQISARVQRQPVNVEVDDGDEAPAIEQVFF
FT                   ETTREKRLPLLISVLSHYQPASCVVFCNTKKDCQSVYEALESRGISVLALHGDLEQRDR
FT                   DQVLVRFANRSCRVLVATDVAARGLDIKDLELVVNFELAFDPEVHVHRIGRTGRAGMSG
FT                   LAVSLCTPQEMTRAHAIEDYLQMKLKWTPAEQVSRSANTMLEPEMVTLCIDGGRKAKIR
FT                   PGDILGALTGEAGLTAADVGKIDMFPVHAYVAIRKASAKRALQQLQQGKIKGKNCKARL
FT                   LK"
FT   CDS             675494..675814
FT                   /transl_table=11
FT                   /locus_tag="Y11_06411"
FT                   /product="DNA damage-inducible gene in SOS
FT                   regulon,dependent on cyclic AMP and H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27540"
FT                   /db_xref="InterPro:IPR009813"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9N2"
FT                   /protein_id="CBY27540.1"
FT                   /translation="MAVEIKFVVVRQGEEKMTFTTKKEADAYDKMLDLADNLSEWLSQS
FT                   PLTLEEEQREALSFFLAENKDALGQILRGANPAVSAEGQPKAKVEKITTEKKSKSEENQ
FT                   AA"
FT   CDS             675854..676162
FT                   /transl_table=11
FT                   /locus_tag="Y11_06421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27539"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR008314"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9N1"
FT                   /protein_id="CBY27539.1"
FT                   /translation="MNREITFFRRFEADILADRKTITIRDSSESDFRPGEILRVCRNED
FT                   GVFFCNILVKSVTPITLDTLTERHAEQENMSLDELKKVIKDIYPGLEQFYVIEFTRC"
FT   CDS             676349..676624
FT                   /transl_table=11
FT                   /locus_tag="Y11_06431"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27538"
FT                   /db_xref="InterPro:IPR025603"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9N0"
FT                   /protein_id="CBY27538.1"
FT                   /translation="MAKVPACTGLTPSQVATQVKRDFLQNRITRWEADKKGLGTDSPVV
FT                   WISTVDITGKDDIWQVPLTARGKKGDKTYQVVLDCKAGTITYILPT"
FT   CDS             676814..678868
FT                   /transl_table=11
FT                   /locus_tag="Y11_06441"
FT                   /product="protease II"
FT                   /EC_number="3.4.21.83"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27537"
FT                   /db_xref="GOA:E7B9M9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M9"
FT                   /protein_id="CBY27537.1"
FT                   /translation="MTTPPKADKRPYPMTMHGDIRTDDYYWLRDDERIDADVLHYLQTE
FT                   NEFTETVLKPQQPLRETLYQEMVSRIPPQEESVPYTRNGYRYQTRFEPGNEYAIYVRQP
FT                   VWADSSWETLLDGNQRAADSEFYTLGGLDVSPDNQLLAVAEDFLSRRQYDIRVKHLQSD
FT                   TWQEEVISNTSGSFEWANDSKTLYYVRKHEKTLLPYQVYRHVVGTDPASDQLIYQETDD
FT                   TFYVGLEKTTSERFIVIHLSSTTTSEILLLDADQQQPLPQMFAPRRKDHEYGLDHYKQH
FT                   FYIRSNKDGKNFGLYKIAEAGKTPADFADESQWISLITPRTEVMLEGFSLFRDWLVVEE
FT                   RSEGLTHLRQIHWATREEKSITFDDPTYVTWLAYNPEPETELLRYGYSSMTTPSSMYEL
FT                   NMDTGARQLLKQQEVKNFTPEKYRSERIWVTASDGAKVPVSLVYHRDHFACGSNPLLVY
FT                   GYGSYGSSMDPAFSGSRLSLLDRGFVFALAHIRGGGELGQQWYEDGKLLNKLNTFNDFI
FT                   DVTKTLVAKGYCDASRVFAMGGSAGGLLVGAVINQAPELYKGVVAQVPFVDVVTTMLDE
FT                   SIPLTTGEYDEWGNPNDKVYYDYIKQYSPYDQVKAQDYPHMLVTTGLHDSQVQYWEPAK
FT                   WVAKLREMKTDDHQLLLYTDMDSGHGGKSGRFKAYEDIALEYAFILSLA"
FT   CDS             complement(678880..679542)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06451"
FT                   /product="exodeoxyribonuclease X"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27536"
FT                   /db_xref="GOA:E7B9M8"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M8"
FT                   /protein_id="CBY27536.1"
FT                   /translation="MYFRVIDTETCGLEGGIVEIASIDVMDGALSNPMSDLVSPDRPIS
FT                   LDAMVIHHITEEMVEGKPRIAVAVRKYQGSPYYVAHNAPFDRGVLPEMGGQWICTLKLA
FT                   RMLYPDIKHSNQYLRYALRLNVSVPDNLYPHRALYDCYVTAALLQRIMRDSGWSAEQMA
FT                   EITRQPQLLSTFKFGKYRGKSIEQIARQDPDYLRWMLASITDLTPDMRHTLTYYLAK"
FT   CDS             complement(679627..679740)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27535"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M7"
FT                   /protein_id="CBY27535.1"
FT                   /translation="MSKGMDSKKNAKKKPLKTPAEKKAEKRAKKSSSTSAE"
FT   CDS             680052..681008
FT                   /transl_table=11
FT                   /locus_tag="Y11_06471"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27534"
FT                   /db_xref="GOA:E7B9M6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M6"
FT                   /protein_id="CBY27534.1"
FT                   /translation="MEQLRGLYPAYEPYDSGLLDTGDGHQIYWELCGNPEGKPAVFIHG
FT                   GPGGGIAPYHRQLFNPKKYKVLLFDQRGCGRSKPHASLDNNTTWYLVDDIERLRNMAGV
FT                   DKWLIFGGSWGSTLALAYGETHPERVSEMVLRGIFTLRKKELDWYYQDGASRFFPDKWL
FT                   RVLSILSPEEQGDVIVAYRKRLTSSDKAVQLEAAKIWSLWEGETVTLLPAKSAASFGED
FT                   DFALAFARIENHYFTHLGFLDSDNQLLDNVTRIRHIPAIIIHGRYDMACQPQNAWDLAK
FT                   AWPEAELHIVEGAGHSFDEPGILHQLILATDKFARKL"
FT   CDS             complement(681058..681291)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06481"
FT                   /product="DNA polymerase III theta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27533"
FT                   /db_xref="GOA:E7B9M5"
FT                   /db_xref="InterPro:IPR009052"
FT                   /db_xref="InterPro:IPR011325"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M5"
FT                   /protein_id="CBY27533.1"
FT                   /translation="MGYNLAELSDEETAKMNVDLAASGVAFKERYNMPVIPEMVAREQP
FT                   DELREYFLQRLAHYRSESNKFSRLPYEPKMKS"
FT   CDS             681674..682183
FT                   /transl_table=11
FT                   /locus_tag="Y11_06491"
FT                   /product="ferritin-like protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27532"
FT                   /db_xref="GOA:E7B9M4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M4"
FT                   /protein_id="CBY27532.1"
FT                   /translation="MLKKEMAQKLNEQLNLEFYSANLYLQMSAWCSDKGFEGAAAFLKE
FT                   HSQEEIQHMQRLFEYLSGTGSMPILGTISAPPVDFASLADVFKLTYEHEQLITNKINEL
FT                   AHVAMTTHDYSTFNFLQWYVAEQHEEEKLFKSILDKLALVGNSGNSLFFVDKDLKTMAA
FT                   QNHVQA"
FT   CDS             682371..682499
FT                   /transl_table=11
FT                   /locus_tag="Y11_06501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27531"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M3"
FT                   /protein_id="CBY27531.1"
FT                   /translation="MIKGDGQGEINFRSIIGYISIATHNLAFYFVPYLTGSAIDWK"
FT   CDS             682574..682960
FT                   /transl_table=11
FT                   /locus_tag="Y11_06511"
FT                   /product="protein yobA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27530"
FT                   /db_xref="GOA:E7B9M2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014755"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M2"
FT                   /protein_id="CBY27530.1"
FT                   /translation="MFIHKVRSSCRMLSALIVLFVGLSSQQALAHAHLKIESPAADATI
FT                   GSAPEAVTLGFSGGIELNFSGVKVTGPDNDVVKTGELKLDPANNTQLILPIDSALKAGK
FT                   YNVSWHVVSVDGHKTKGTYSFTVK"
FT   CDS             682962..683846
FT                   /transl_table=11
FT                   /locus_tag="Y11_06521"
FT                   /product="copper resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27529"
FT                   /db_xref="GOA:E7B9M1"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M1"
FT                   /protein_id="CBY27529.1"
FT                   /translation="MSLATLFVLCRFLHFLAVMLMFGISIFTAVLAPDRFSSILKNRLS
FT                   PLLMLSTFLGLASAIGLLAIQAGMMGDGWSDTYRLSVWWAVLGTRFGEIWQWHLGLSIL
FT                   SMWVVLLGTTRLYYQLMLACSTLLLASLAFTGHAAMHDGVLGWVHQTNQIIHLLSAGYW
FT                   LGCLPALLVCLAYTRRDDVKREAITTLIRFSSWGHLAVALVLATGMINSIIILRETSLT
FT                   LISVYQMLLLSKAILVLFMIVVAIINRYLIVPMLRKLPVKAHYWLVVNSCAEIVLGAAV
FT                   LLLVSIFATMAPV"
FT   CDS             683943..684284
FT                   /transl_table=11
FT                   /locus_tag="Y11_06531"
FT                   /product="putative periplasmic or exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27528"
FT                   /db_xref="InterPro:IPR019648"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9M0"
FT                   /protein_id="CBY27528.1"
FT                   /translation="MKGLVLTLSLLMLSMNAFAAGKIVTVSKFEFGKQWAFTREEVMLE
FT                   CRSGGALFVINPSTLAQYPLNDVASEQMKAGHVLAKPLDILLLDDSENSGQKMSLLPFQ
FT                   QRAMTLCEK"
FT   CDS             complement(684610..685554)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06541"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27527"
FT                   /db_xref="GOA:E7B9L9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L9"
FT                   /protein_id="CBY27527.1"
FT                   /translation="MEQARHKPWLGEKDDRRKLLELIDLWYQLHGCSLSDKKGRLAKLE
FT                   IICKGLGNPIAADITPKDWAHYRDQRLRGEINNGYSTSLRTRMVTTGTVNSEQAYLRAV
FT                   FNELTRLGEWSLPNPLMNIREFDQPEREMAWLNDDQIDSLLDACDLHGNPELTLIVRLC
FT                   LSTGARWNEIAKIKASQISPNKITFINTKGKKNRTVPLSEDIYQALAARKGKPFEPCYK
FT                   QFYRVIRLAQIELPVGQMTHVLRHTFASHFMMAGGNIIVLQRILGHSDIRVTMRYSHFA
FT                   PDHLEDAIHFNPLARFESGCKVAIEDEIASNEE"
FT   CDS             685921..686736
FT                   /transl_table=11
FT                   /locus_tag="Y11_06551"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27526"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L8"
FT                   /protein_id="CBY27526.1"
FT                   /translation="MSSDMGAFGSAARDLSKNPLGIIALFIVLVYGFACLLFGFSTKTL
FT                   PTEQQWLLVGFVVFFPLIVLMLFGWLVSKHHDKLYGPSDYRDDTAFLEISSRAKIQVQA
FT                   QQKATKLEFTSSIHDKSADVRDLLAYGEQFSSSVESATESIIVDLKKRTLNYDSVTETV
FT                   LIRQLAVARVLIWFEQVYRVIFGSQISLLLEIKEKSDGESYEKIKKVFDENKKSSNNLF
FT                   ADWDFSQYIKYLITQELILVKDGSVFITSRGIDFLKILELSNYTTDKSL"
FT   CDS             complement(687135..688277)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06561"
FT                   /product="gene D protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27525"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L7"
FT                   /protein_id="CBY27525.1"
FT                   /translation="MMTGLPLTAGTDLAPDFMLTLNQQDITQNIRDRLLSLSLTDNRGF
FT                   EADQLDIELDDADGQLAMPQRGAVLSVFLGWKGSALIGKGDFTLDEVEHHGAPDRLTIR
FT                   ARSADFRGSLNTRREVSYHDTTLGKVVAQVAERNNLQAMLAEGLADITIPHIDQTQETD
FT                   AKFITRLASLNGAVAAIKACRLLFIKPGSAVTASGKPIPQMTITRQDGDQHSFSIADRG
FT                   AYTGVSASWLHTKKPMPKKVKLQRKTQFKHLRALQHPKIKAPQKSQSVEERRGDYLAGS
FT                   GDNVFAITTVYATQKAAMRAAQAKWEKLQRGVAEFSITLAMGRADLFPETPIMVSGFKS
FT                   VIDQQKWIISKVAHHLNNSGYTTQLALEVLLSDVNYSVTV"
FT   CDS             complement(688274..688726)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06571"
FT                   /product="phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27524"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L6"
FT                   /protein_id="CBY27524.1"
FT                   /translation="MMLSLGLFVFMRQTMPYQNMNRNIDYRWPTNSRIGLRPAAQFLGV
FT                   DSEKITLSGVLLPELTGGKLSLLALELMAAQGKAWSLIEGTGTIYGMFVIESLNQTRTL
FT                   FFADGSARRIEFTLNLLRVDESLTAMFGDLQQQADQLVGKMKRCLS"
FT   CDS             complement(688729..689946)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06581"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27523"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L5"
FT                   /protein_id="CBY27523.1"
FT                   /translation="MAATEPTVNLSLDQIQRVSDVMSKGFTSSNTNLLELGEAMKGAVK
FT                   LVAAAGNGKLAEKQSKLKNADGTAQSIATVRMDNLDGDLKNLSSAWEDLEIEVFEKQDS
FT                   ALRKLTVTATDWLINVAAWAKKNPELVGTITKVTGAALSLVAGLGALGLIVWPVMAGFN
FT                   LLLAGAGLLSTGFSLMAGTIATALTVLTWPIVAVVAAIVAGGLLIRKYWEPISAFIAGV
FT                   AEGFTAAIGPISAAFEPLKPVFNWFSDKVRQLSNGFADLIKPVKATQETLDVATNTGKL
FT                   FSEGLAAALSLPMNALNTLRSGIDWVLEKLGIIDTQSNGLTDNVPTDNPFAGGYSPSGG
FT                   VLTGSYQPVSTNNRVAVQDNSTHETHLVFPIPPGTSPQEVQRLVTTEMAKQAREHRTRQ
FT                   RSQMEN"
FT   CDS             689981..690502
FT                   /transl_table=11
FT                   /locus_tag="Y11_06591"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27522"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L4"
FT                   /protein_id="CBY27522.1"
FT                   /translation="MSWVRTTSVGEKAVEPPISRACSGLSVITACKLTSLSRASFYRCS
FT                   ADWREKDKAVIDAIQAVLSESPQAGFWKCYYRLRFKGFTFNHKRVYRVYCWLGLNLKRR
FT                   IKKTLPKRENKPLSVVNRPDIQWALDFMHDALCCGKRFRTLNIIDEGTRECLAIEVDTS
FT                   LPTDRVHYEI"
FT   CDS             complement(690861..691625)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06601"
FT                   /product="conserced hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27521"
FT                   /db_xref="GOA:E7B9L3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L3"
FT                   /protein_id="CBY27521.1"
FT                   /translation="MCKNNQHLRLPNETPLQLRLLWDSSDEPWGFKDLDSRYLHANIPF
FT                   LELLNLSPKFRIKGLSDGDLPHPTFTKFSSQFREQEQLAAITKKRVSSIEMHYFGHEQK
FT                   LQPYLFDKFPLLNSKKECLGIIFHGKKMDFLAGEQYINQELPLTLLFEKPDNSFTDEEF
FT                   DVIFYLLQNISNKAIAQKLALSEQKVEGYRSDIYLKARSDSFYDFKKFCKKNGYSNYIP
FT                   QKFLEPRSIIIPNSEWNIGNTDQAVEKDSTNS"
FT   CDS             691829..693142
FT                   /transl_table=11
FT                   /locus_tag="Y11_06611"
FT                   /product="cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27520"
FT                   /db_xref="GOA:E7B9L2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L2"
FT                   /protein_id="CBY27520.1"
FT                   /translation="MNGLHLLGDDYSVSRLPVSAKSSFISVTLVRVGAITTLAQFMLGA
FT                   TLGHAMTFNQAMLATFLGSLLLQFVSLGLGIAGAREGLSISLLARWCGFGRIGSIIIGC
FT                   GIAISLLGWFGILNAVFAESLHHMLGDLISFSWAAAISGIGFTILVAFGFKALSWTAKL
FT                   AVPLFFLAIFWISLNLLAGHNIADLAVVIPTGKPITIAAGATMVAGGYIVGALMTPDIS
FT                   RYCKNSRHVFWMTMICILVGEFIVNGIAILIAHALNTDDVVTIMIQTSGWIGLLTVILA
FT                   TIKINDVCLYSSSLALTNVVQGITGNRLSRTWLTVLLGIVGTILSMAGILDKFTDFLTL
FT                   LGVVFPPISGVMLVDYYVLRTNRQLLDASRQTQTLPKSTQLIGWKAIVACVVGTIGGMN
FT                   IDYGIPSFNSLIIASAVYWIICIIDKKHDFILQRCYIY"
FT   CDS             693196..693897
FT                   /transl_table=11
FT                   /locus_tag="Y11_06621"
FT                   /product="putative LuxR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27519"
FT                   /db_xref="GOA:E7B9L1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L1"
FT                   /protein_id="CBY27519.1"
FT                   /translation="MNNINHKNIMSFKGIDAGSFGSLLSFMENNEEPWGVKDCESRFMY
FT                   ANKATLKFSQLPINFSIEGRLDNECPAQWADFAPDLQRQDREVETAKKRVAMIQTCLWG
FT                   QEHTLCEKYPLFDNEKKCIGTIFHVTKFNFISLYDLFNKEIPPVLVIYPPTNDFTKKEL
FT                   EVIFYLLQSLNSKEIGERLNLSKRTIENKLQLIYGKVNVNSLSSFKEYCKVEGFERYIP
FT                   EWLIKRGCVFI"
FT   CDS             694134..694349
FT                   /transl_table=11
FT                   /locus_tag="Y11_06631"
FT                   /product="ISsod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27518"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9L0"
FT                   /protein_id="CBY27518.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKQLTEAALAAELDS
FT                   HLVQDLEANRKNGSGKKTIKAPTRSL"
FT   CDS             694395..695336
FT                   /transl_table=11
FT                   /locus_tag="Y11_06641"
FT                   /product="ISsod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27517"
FT                   /db_xref="GOA:E7B9K9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K9"
FT                   /protein_id="CBY27517.1"
FT                   /translation="MKKHQTTLSDEIERKIIRMFALGMSYKDISQEIEDLYAFSVSSAT
FT                   ISAVTDKVIPELKQWQQRPLEAVYPFVWLDAIHYKIRENGRYQSKAVYTVLALNLEGKK
FT                   EILGLYLSENEGANFWLSVLTDLQNRGVNDILVACVDGLTGFPEAINSIYPDTEVQLCV
FT                   IHQIRNSIKYVASTHHKAFMADLKPVYRAVSKEAAETELDELEEKWGQQYPVVLQSWRK
FT                   KWENLSHYFRYPATIRKVIYTTNAIESVHRQFRKLTKTKGAFPNENSLLKLLYLGLMNA
FT                   QEKWTMPIQSWNLTLSQLAIYFEGRLDKVITL"
FT   CDS             696178..696834
FT                   /transl_table=11
FT                   /locus_tag="Y11_06651"
FT                   /product="putative SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06651"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27516"
FT                   /db_xref="GOA:E7B9K8"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR016584"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K8"
FT                   /protein_id="CBY27516.1"
FT                   /translation="MERNTHDGAKVYNPLTLKLYDWWVLGVSNRFAWRCATDKHLLPFF
FT                   LQNTGKKHLDIGVGTGYYLAHVPEDCFVSMMDLNSSSLNAAASRVGKGRIQYIIQHDVF
FT                   TSYPDSLHEQFDSVSMFYLLHCLPGDMSGKSPVIRNATKSLTNNGKLFGATILGAGVEH
FT                   NTFGQKLMNVYNGKGIFSNRNDSSEGLRQILSEHFMEVSITIKGTVALFSASRKK"
FT   CDS             697686..698888
FT                   /transl_table=11
FT                   /locus_tag="Y11_06661"
FT                   /product="ISsod5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06661"
FT                   /db_xref="EnsemblGenomes-Tr:CBY26876"
FT                   /db_xref="GOA:E7B5V4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E7B5V4"
FT                   /protein_id="CBY26876.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKQLTEAALAAELDS
FT                   HLAQDLEANRKNGSGKKTIKAPTGRFELTTPRDRNGTFEPQLVKKHQTTLSDEIERKII
FT                   RMFALGMSYKDISQEIEDLYAFSVSSATISAVTDKVIPELKQWQQRPLEAVYPFVWLDA
FT                   IHYKIRENGRYQSKAVYTVLALNLEGKKEILGLYLSENEGANFWLSVLTDLQNRGVKDI
FT                   LIACVDGLTGFPEAINSIYPDTEVQLCVIHQIRNSIKYVASKHHKAFMADLKPVYRAVS
FT                   KEAAETALDELEEKWGQQYPVVLQSWRKKWENLSHYFRYPATIRKVIYTTNAIESVHRQ
FT                   FRKLTKTKGALPNENSLLKLLYLGLMNAQEKWTMPIQSWNLTLSQLAIYFEGRLDKVIT
FT                   L"
FT   CDS             699243..699404
FT                   /transl_table=11
FT                   /locus_tag="Y11_06671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06671"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27514"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K6"
FT                   /protein_id="CBY27514.1"
FT                   /translation="MVLSSDQFGDAISYFNFLNTNILIALYYEMAILALILSYLMTKLI
FT                   FHFMRKDK"
FT   CDS             complement(699945..700763)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06681"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06681"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27513"
FT                   /db_xref="GOA:E7B9K5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K5"
FT                   /protein_id="CBY27513.1"
FT                   /translation="MGIKIVAVDMDGTFLNDQMNFDRKRFSAQYAQLKDNGIKFVVASG
FT                   NQYYQLISFFPDIADEIAFVAENGAYVSNENTEIFCGELSDENCDKVLKTILPLPHLDI
FT                   IVCGKNGACMLSSSDNAFYTTMSKYYHRLKIIDNFSQIEEPAFKFAISLPDEELADFMT
FT                   FIEAELGGIVTPVSSGHGSVDLIIPGVHKANGIKLLQNIWGVKDEEVVTFGDGGNDVEM
FT                   LQYAGFGFAMANAPDRIKEIAKYQADSNNNSGVLNIIDKILRKEPPFAGS"
FT   CDS             complement(700944..702029)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06691"
FT                   /product="membrane protein mosC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06691"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27512"
FT                   /db_xref="GOA:E7B9K4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K4"
FT                   /protein_id="CBY27512.1"
FT                   /translation="MGLWASLVPYAQNRLHFDAGSLGLLLLCLGTGSLLAMLFSGKIIG
FT                   RFGCRNIMLLGIVLACIFLPTLAIIDQFPLMALCLFFFGAGIGLADVAVNVQGSLVEQS
FT                   SDKPLMSGFHCLFSVGSIAGAGGGAILFTLGLMPLAVTFIAIAVIAIITVTVFNELIPF
FT                   GDHKEPTEQAITKPRPNFRLVLMAIMCMICFMAEGAVLDWSGVFLTNDRGLDITHAGWG
FT                   FAIFGGTMSFMRFTGDKVVSLLGRKRVLVLSSIIAMIGYAVAVIIPDWKFTLLGFALVG
FT                   VGAANIVPVLITLAGQEKVMPVNMSVAMVATLGYFGVLGGPALIGFIAHLTDLYTAFAI
FT                   MALTFLIIAVGAFKLKYVNEE"
FT   CDS             complement(702353..703378)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06701"
FT                   /product="putative ROK-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06701"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27511"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K3"
FT                   /protein_id="CBY27511.1"
FT                   /translation="MTTVLINTTRQMKKKNIMLVTGTLKSLVSATKSDISAQTGLSLAT
FT                   CGTILNELCAEGEVIEESLDESRGGRPAKRYIYNPNYFSVLSVYTEGTNDSGVISSYLT
FT                   SADGKKTQEYNEVYNSLTVDILINHIKDIIDKHPNIKALGLGLPGVVVDGKVLTCDITH
FT                   LEGLDIAEQLNNQLGIFVQVGNDMNYTAFGFYRNYCRGTNDPVAYIFMPPRHCAGCGMV
FT                   ISGKMLRGASQFAGEVSKLPFYNNLTNGKNTNFHHTPEFERLLHITSSLIVIINPVTIA
FT                   VSGNNIDQACIDALAIELLKKFDSKHIPQFVYRDCIKSDYHKGISEYTLDAYNNFRVFD
FT                   S"
FT   CDS             703664..704017
FT                   /transl_table=11
FT                   /locus_tag="Y11_06711"
FT                   /product="putative uroporphyrin-III c-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06711"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27510"
FT                   /db_xref="GOA:E7B9K2"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K2"
FT                   /protein_id="CBY27510.1"
FT                   /translation="MSINKVTLQRVYDVEPPYQANTFLVDRLWPRGISKARLEGVVWLK
FT                   EVAPDNALRQWFHQHLDWPEFVIRYRAQLNNSTAWEPLLAVLKQQPITLLYGSRDEQNN
FT                   QAVVLRDFLLSKL"
FT   CDS             complement(704206..705672)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06721"
FT                   /product="L-asparagine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06721"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27509"
FT                   /db_xref="GOA:E7B9K1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K1"
FT                   /protein_id="CBY27509.1"
FT                   /translation="MSMMSGKHSAETHHDAKKRWLDSHDTGYHKSMGRRHIQMIAIGGS
FT                   IGTGLFLGTGARLQMAGPALALVYLVCGVFSFFILRALGELILHRPSSGSFVSYAREFL
FT                   GEKASYVAGWMYFLNWAMTGIVDITAVALYMHYWGTFSDVPQWLFALGALSIVATMNMI
FT                   GVKWFAEMEFWFALIKVAAISIFLIVGVVFLGTGQSVGEHSSGMHLITDNGGFFPHGLL
FT                   PALVLVQGVIFAFAGIELIGTAAGECKDPEKMLPKAINSVILRIGLFYVGSVVLLVCLL
FT                   PWNAYQAGQSPFVTFFSNLGVPYIGTIMNIVVLSAALSSLNSGLYSTGRILRSLSMGGS
FT                   APKFMSKMSPQSVPYAGILVTVGIYVFGVVLNFLVPSQVFEIVLNIASLGIISSWAFII
FT                   VCQMKLRQAIKNGTAKPVAFKMPGAPVTSWLTLFFLAGVLIMMALDYPNGTWTVATLPV
FT                   IAVLLVVGWFSLRKRAREVAAEHRNMPEWR"
FT   CDS             706728..708086
FT                   /transl_table=11
FT                   /locus_tag="Y11_06731"
FT                   /product="citrate-sodium symport"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06731"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27508"
FT                   /db_xref="GOA:E7B9K0"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9K0"
FT                   /protein_id="CBY27508.1"
FT                   /translation="MKKTNQDITLASDEEIDMADKFSIKTLITNVNKMNINTMPMALFM
FT                   TISAIVFISAYASYLPKNMIGGLAVIMTMGFVLSHIGRHIPVLKDIGGPAILCLMVPSV
FT                   LVYFGIFQTNTLDTVRLLMKEANLLYFVIASLVVGSILGMNRVVLIQGMTRMFIPLVVG
FT                   TITAVATGLLVGKLFGFSLYHTFFFIIVPIIGGGIGEGILPLSLAYSAILGQAPDVYVA
FT                   QLAPAAVVGNIFAIICAGVLARIGMRRKDLNGEGILIRSAQDNAVFTSQEGPKQADFQL
FT                   MGGGLLMTCAFFIVGGLFEKVVHIPGPVLMILIAVMCKYGQVIPSKMEQGAHSWYKFVS
FT                   TTLVWPLMIGLGMLYVPLESVVAVFSVGYVVVCGSVVLSMAAISFIIAPYLNMYPVEAS
FT                   IVTSCHSGLGGTGDVAILSASNRMSLMPFAQIATRIGGASTVIGATLLLGWII"
FT   CDS             complement(708383..708973)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06741"
FT                   /product="transcriptional regulatory protein CitB, DpiA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06741"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27507"
FT                   /db_xref="GOA:E7B9J9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J9"
FT                   /protein_id="CBY27507.1"
FT                   /translation="MTAEQPIHLVLLDVFMRQDNGLDLLPVLREFSEHTDVIVISSATD
FT                   VNTIKKALQYGVVDYLIKPFQFSRFEEALSTYREKQSLLGQREYCAQEDVDSLLRRSNA
FT                   TPVERKKLPKGLTAQTLRTVCEWILEVQDGEFSTEQMANAIGISRVSCRKYLIYLSDTE
FT                   VLSTKVLYGATGRPVYLYKLLPSQQEVLKQYCQ"
FT   CDS             complement(709095..710771)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06751"
FT                   /product="sensor kinase CitA, DpiB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06751"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27506"
FT                   /db_xref="GOA:E7B9J8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J8"
FT                   /protein_id="CBY27506.1"
FT                   /translation="MNNATTAGKQKVPLRLSTSITLMVSAVIISVLLVVHTLFFVQLSK
FT                   MAQEGLQDKAVAVARSLSFSPTIIHGLTDPEAGKQIQSYTSQVQKANNLLFIVVTDMNG
FT                   IRYSHPNPEMIGQHFIGNDLEPALQGKENSAINRGVLERALRIFIPVYEPYGKQIGVVA
FT                   IGISLTSIDSVVSETRWTIPWTILFGALIGSLGTWFLVKALKRIMLGFEPYEISNLFEQ
FT                   RNAMLQSIKEGVIAVDANSRITVVNHEAKRLFKQSGPMENLLLSSASKYWPVRLYLEQV
FT                   LETGIARRDEEINFNGSILLTNTVPVMVKGDIIGAIATFRDKTEVSQLMQRLTGMVHYA
FT                   DALRAQSHEFMNKLHVILGLLHMKYYQQLEDYIVKTSNNYQAEIGSLLRKVKSPIIAGF
FT                   LLGKINRARDLGITLSISDDSLLPDTNNEQITTTLITVLGNLIENAMEAIGNQSQREIN
FT                   VSFHYQNGRVHCVVSDDGPGIATELQGSIFDNGFSTKGNEHGIGLSLVRQSLESIGGNI
FT                   EFDSEAGVFTQFFINLPYEVTSNNMTSSDNYSNNISAVNHD"
FT   CDS             complement(711016..711795)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06761"
FT                   /product="putative deoR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06761"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27505"
FT                   /db_xref="GOA:E7B9J7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J7"
FT                   /protein_id="CBY27505.1"
FT                   /translation="MIPVERHQQILALVAERGVVSIAELTERLGVSHMTIRRDVQKLEE
FT                   QGAVLSVSGGVRSTERLAAEPSHQDKTLMYSSQKNAIGMAAALHIPRNSCIYLDAGTTT
FT                   LALARQLEARDDLLVVTNDFVIANFLIESCQCKMIHSGGTLCRENRSCVGDAAARALRN
FT                   LSIDIAFISASCWGPRGISTPDEDKVVVKRAVSEVSSKRVLLADASKYGKIATYLALPL
FT                   IDFDAVITDTGLASTAHEELATKEIELIIAPTLRQSD"
FT   CDS             712318..713580
FT                   /transl_table=11
FT                   /locus_tag="Y11_06771"
FT                   /product="putative pyridoxine biosynthesis protein
FT                   (probably from glycolaldehide)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06771"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27504"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J6"
FT                   /protein_id="CBY27504.1"
FT                   /translation="MRLGVIADDFTGATDIASFLVENGMSTVQVTGIPQTDYQVRADAI
FT                   VISLKSRSGSAEKAVADSLAALAWLQHQGCTQFYFKYCSTFDSSAQGNIGPVTDALMDA
FT                   LAQQQTVICPALPINGRTVYQGYLFVMGQLLSESGMRHHPVTPMTDSNLLRLMDAQSRG
FT                   RSGLINSSVMDQGVDTVKSHLRSLKDEGIRYVVLDTLNDDHLLTQAEAVCDMVLVTGGS
FT                   GLAIGLAQQWMKGVQHHLPATLTGAPQGKLCVVLSGSCSAMTHRQVARYVQQAPAQSID
FT                   ITRCLNEPESYAKELCTWVMENISGPLAPLLYATSKPDVIQSIQRQWGAVTSSEAVEHL
FT                   FGTLARSLQLQGVQRFIVAGGETSGIVAQSLGIQAFHIGPAISPGVPWVKSTDHPISLA
FT                   LKSGNFGDENFFARAQTEFAV"
FT   CDS             713577..714068
FT                   /transl_table=11
FT                   /locus_tag="Y11_06781"
FT                   /product="ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06781"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27503"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J5"
FT                   /protein_id="CBY27503.1"
FT                   /translation="MNEQQAREDMVKLGASLFQRGYATGSAGNLSLKLADGTLLATPTG
FT                   SCLGELNAERLSKVSLAGEWISGDKPSKEISFHRAIYLNNPECEAVVHLHCLYLTALSC
FT                   LQGLDYHNAIKPFTPYVVMRVGDVPVVPYYRPGDPRLGEALTKLAPQYRAFYWQITARS
FT                   "
FT   CDS             714068..714199
FT                   /transl_table=11
FT                   /locus_tag="Y11_06791"
FT                   /product="ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27502"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J4"
FT                   /protein_id="CBY27502.1"
FT                   /translation="MGKSLREAADNMEELEETARLIFTLGDRPIRYLTDDEIAELRS"
FT   CDS             714202..714981
FT                   /transl_table=11
FT                   /locus_tag="Y11_06801"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06801"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27501"
FT                   /db_xref="GOA:E7B9J3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J3"
FT                   /protein_id="CBY27501.1"
FT                   /translation="MPKFAANLSMMFTEVPFLERFKAAKDAGFGGVEFLFPYDYPADQL
FT                   AAKLKEQSLQQVLFNSPPGDISAGEWGLAALPSREKEARRDIDLALEYALALGCPSIHI
FT                   MACVVPVGADRKNYQQTFIDNVRYAADRFAEHNINVMIEALNPKIKPNYLFSSQYQTLE
FT                   LVNLIKRPNVFTQLDLFHAQIVDGNLSHLITAFAGRYGHIQIASVPGRHEPDEGEINYA
FT                   YLFGLLDEINYRGWIGCEYHPRAGTVAGLSWMQPYLS"
FT   CDS             715547..716554
FT                   /transl_table=11
FT                   /locus_tag="Y11_06811"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06811"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27500"
FT                   /db_xref="GOA:E7B9J2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J2"
FT                   /protein_id="CBY27500.1"
FT                   /translation="MPTDDSKNGIIDYVSTGHLPDPDTVVKLVQEAHKRFSTDNEGVVS
FT                   TVYPALERIPPNLFGVCMVGTNGKVYSAGDVDYEFTIMSVSKPFVFALVCQAIGAKVAR
FT                   EKLGVNSTGMAFNSVTAIERAPDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCR
FT                   FAGRELTLNEEVYQSACETNFRNRGIANLLEGYGRLGCDPLIATDLYTRQCSLNVSARD
FT                   LAVMGATLADGGVNPLTRERVVDNDVCHYALAVMVTAGLYETSGDWLYDIGLPGKSGIG
FT                   GGIVTVSPGKGGLGTFAPLLDSAGNSVKGQLAARFLSRSLGMDMFVSEPYTEKS"
FT   CDS             716666..718306
FT                   /transl_table=11
FT                   /locus_tag="Y11_06821"
FT                   /product="putative MFS Superfamily multidrug efflux
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06821"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27499"
FT                   /db_xref="GOA:E7B9J1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J1"
FT                   /protein_id="CBY27499.1"
FT                   /translation="MANQSTHRAGAEVKESWVPMITIALAQILMSFNVASLPVALGGMV
FT                   KSFNVPPTTIATAIVMYSLSVAGFVMLGAKLNQRFGPLVVFRSTVLLFGVAQVMMTFSP
FT                   NVTVMISAQALSGLAGAALVPALVALIAENYRGTQQATALGALGSARAGAGVAAFLIGG
FT                   VLGTYIGWRPAFGILIVLSAIIFVLSFRLKSDQGRPEVGIDVFGVILAASAIILLSFGF
FT                   NNLNRWGFGLVRDGAPFDLLGFSPAPFMIVLGIVLGQAFVVWTRRRQEQGKTPLLALEV
FT                   LSSPTEKAAVFAMFAVVALEAMLNFSVPLYIQIVQGSTPMATAIAMMPFNLSVFFSAML
FT                   IVRFYKKLTPRKIGRYGFITCTIALLWLAFVVRNNWSEFAVLFGLVVFGLAQGALVTLL
FT                   FNVLVSASPKELAGDVGSLRGTTNNLANAIGTAVAGALLVGLLSANVIRGVAETPILTP
FT                   EIQAQVNMDSINFVSNDRLQGVLAQTTATPEQVAEAVRVNEEARLRSLKFGLLIMALLS
FT                   LLAIFPAGRLPNYLPGELPADNLVKKTGK"
FT   CDS             complement(718423..718941)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06831"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27498"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9J0"
FT                   /protein_id="CBY27498.1"
FT                   /translation="MSHIQTEYEQVRAIIGDNSLTTLLSIGHDSTTVVTGSSGMVFAEQ
FT                   RLTVGSNHVALRYFKHNPPTPDEMETAIMVVEDEVIRISPAVNKTSQLITTDGYIAEIA
FT                   HLAGLPTQAEIVMSLESVERMFDRLAAVMMGRTAASEGIPADNEFAARLLILREFMHHL
FT                   QFSAITVLR"
FT   CDS             719115..721052
FT                   /transl_table=11
FT                   /locus_tag="Y11_06841"
FT                   /product="putative high-affinity iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06841"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27497"
FT                   /db_xref="GOA:E7B9I9"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I9"
FT                   /protein_id="CBY27497.1"
FT                   /translation="MRIWHKLFLLCCCWWLSSSLAWATPDYQQWVNDIQSRLDKTSQLY
FT                   QQQKNDEARTTVQMAYFEVFENLEGPIRINISAQKSYQMEAAFGEIRRMIGEGKPQAEI
FT                   DNKINWLKGELTGVLPILTDGHKLTAEQQHATYENSDIAVYWQQSFKIIDDLLAQAITE
FT                   YQEGKFDAASQSVQQAHYLGFKNSEMEMSVRGNRSAQQAATINQQFTALIDLTRKPDQL
FT                   TEVAYRVTGLLQTIEDTLPGLPTTREQQQVTADQPVSGQPSDSNTNSDGQANADWTAVS
FT                   GKINQAISEAVSQYQSGQTTPAMMAVQDAYFDLFEASGMENKVGSRDAAFKSTLEGHFT
FT                   RLVSLMKAGQPVEQLQTEVAALQKDLASAVEMLGGGDETDWSLFIYSLLIIVREGLEAL
FT                   LIVAAIVAYLVKNNHQDKLPLIRQSVVVALIASVLTAFVFQWLFANSGQSRELLEGFTM
FT                   MIAVVMLFSMSYWLLSKTEARQWKAYLEGKFSKSLSSGSMIGLWLTTFLAVYREGAETV
FT                   LFYLALMGDASTTSGHLSILAGFGVGCVILLVAYLVMRFTVVKLPLKPFFMFTGGFMYL
FT                   MAFVFAGKSVLELIEGKLFEPTLLPGVPEISWLGIYPYLETLIPQGILLIAALVALWVM
FT                   QRRGRAIPAQ"
FT   CDS             721132..721659
FT                   /transl_table=11
FT                   /locus_tag="Y11_06851"
FT                   /product="periplasmic protein p19 involved in high-affinity
FT                   Fe2+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06851"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27496"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I8"
FT                   /protein_id="CBY27496.1"
FT                   /translation="MTMKKTIIASSIIASIFAAPAAFAFKEYPAGEPIKINDMEIAAVY
FT                   LQPIDMEPRGMGLPAAKADIHLEADIHATEGNKNGFGAGEWMPYLTIAYTLVNTDTGAK
FT                   QEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHISEPSKAGLHRHTDSETGVGRWWKPF
FT                   DVSYDFKYTGLN"
FT   CDS             721915..723198
FT                   /transl_table=11
FT                   /locus_tag="Y11_06861"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06861"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27495"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I7"
FT                   /protein_id="CBY27495.1"
FT                   /translation="MVVVGMWAGTHYPKSQQLQLVLAGGQILSLILFLFSQLTPSRALG
FT                   YCWQALLVLGAAFNWGNNPNLGAFTNTHVINTDLLLNLAAIVVAFVWVVFGAVLLLMMV
FT                   RQLRYIRWPLLILLTLLLILPLSGDAILLLMKLQVLPLTKSLLSYVALVTNGHAWLSYI
FT                   CALLLAITTLCYLMPLRRASEVVAEHSEPIAHRKALADYRNVRRIFIFSLLAWIVVAGA
FT                   QLYWDKVASQPPQLSEALPVTLAADGLVHIPVEQVRDGKLHRFIWVADDGKAVRFFIIN
FT                   RYPDRLRLSVVFDACLLCGDQGYVMEGNQVICVACAVHIFIPSIGKAGGCNPIPLEDWK
FT                   SDDKELVIPKASLEAGVNYFTTVVTLDVIDPVDKTHLTNQKAEYKYSYGDKTYFFSSEA
FT                   NYNRFREHPEQFVTPVLSDENSDSQENP"
FT   CDS             723201..724346
FT                   /transl_table=11
FT                   /locus_tag="Y11_06871"
FT                   /product="similar to ABC transporter: eg YBJZ_ECOLI
FT                   hypothetical ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06871"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27494"
FT                   /db_xref="GOA:E7B9I6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I6"
FT                   /protein_id="CBY27494.1"
FT                   /translation="MLWRMLKQSWFRNVRRKSLAVFTVFLAAGLISSLLAVSIDIGDKM
FT                   SRELKSYGANILIEPAGQVALPSLFGEKSNPLTGQDFLDQAELPNIKDIFWRNNIVGFA
FT                   PLLSGETEVNGQDIPLLGTYFNQPVDVPDEEDYHTGQQIISPYWQVNGNWPQEPVKPDV
FT                   TEVEALLGKQLAQQTGWKIGDELDLNGASGPLKVKISGVLSSGGEEESRLVLPLAAVQS
FT                   LLGLPGKVQAIRVSALTVPENELSRKARENLEALNAEEYDLWYCTAYVSSIAHQLEEAI
FT                   SGSVVRPIWQVAASEGVVIEKIQLLLAVVTLAALIAAAMGIASLMTSTIMERAKEIGLM
FT                   KALGARQWQILMLFYLEAAISGLIGGLAGCLAGWGWQKPSA"
FT   CDS             724325..724492
FT                   /transl_table=11
FT                   /locus_tag="Y11_06881"
FT                   /product="similar to ABC transporter: eg YBJZ_ECOLI
FT                   hypothetical ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06881"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27493"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I5"
FT                   /protein_id="CBY27493.1"
FT                   /translation="MAKTIGLMLFGAPLSFAWMVVPCVLVISVLIAVIGTWFPARRIAG
FT                   LYPVEVLYGR"
FT   CDS             724482..725639
FT                   /transl_table=11
FT                   /locus_tag="Y11_06891"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06891"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27492"
FT                   /db_xref="GOA:E7B9I4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I4"
FT                   /protein_id="CBY27492.1"
FT                   /translation="MAVNHRAIQHKGLDGMFWRLVLRALRLRLQRVSVVFAALTVGAAI
FT                   VTAMSAVYFDINAKMSQELRTFGANFYIGPGHGSTFEQGRFQPIIDAAPKGLINASSPY
FT                   IYGMARTELEKVVLMGVWFESLQQLVPYWQVTGNWIGVSFDDRNAMIGIKLAERLHVKV
FT                   GDTLTLVNGSERQRLQVKGIVEAGDATDNMLIVNLELAQKWLNQPGHISNALLSVSNDA
FT                   GQVETFASHLREQYPDLEIRPIRKVSASEGQVLDKIKGLMGLVSVVILILSSLCVNTTL
FT                   MAIVGERSKEFALQKALGASGGDIIRQMLIETLIISLAAAVCGALLGYILAQVLGQTVF
FT                   SAAIALRAPVLPLTLVLSLLVAAVAAIVPTRRAIHIEPAKVLKGE"
FT   CDS             725643..726356
FT                   /transl_table=11
FT                   /locus_tag="Y11_06901"
FT                   /product="ABC transporter, ATP-binding subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06901"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27491"
FT                   /db_xref="GOA:E7B9I3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I3"
FT                   /protein_id="CBY27491.1"
FT                   /translation="MTSSLLRVQPEHDTDAVIETRHLYKRFGQVTALEDINIRINRGEF
FT                   VAIMGASGSGKTTLMNILTCLDTVTEGQVLLDGIDAAGLDEEGRRKFRADKIGLVFQQF
FT                   HLIPYLTALENIMLAQHYHSVVDEDAARQVLEQVGMTPRMSHLPSQLSGGEQQRVCIAR
FT                   ALVNQPPIIFADEPTGNLDEENEQRVLDLLNHIHRQGRTIVMVTHNPDLGCVADRIIRL
FT                   QHGKYLNEESNHHVA"
FT   CDS             726346..726834
FT                   /transl_table=11
FT                   /locus_tag="Y11_06911"
FT                   /product="putative thioredoxin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06911"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27490"
FT                   /db_xref="GOA:E7B9I2"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I2"
FT                   /protein_id="CBY27490.1"
FT                   /translation="MWRKTVGLCALLLLLSACKQEEVAVGEVAPQLAAYDLQGKPVALE
FT                   QWRGKQVYLNFWSASCGGCLAEMAALDKLSQQYQQDIVVVAINTDPEQVDIAPVLAQRN
FT                   ISYPVIRDQLGITQERYQVIGTPTSFMIDRNGKVTELHQGARDEKALTTLFQQWAAGA"
FT   CDS             726834..727148
FT                   /transl_table=11
FT                   /locus_tag="Y11_06921"
FT                   /product="putative cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06921"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27489"
FT                   /db_xref="GOA:E7B9I1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I1"
FT                   /protein_id="CBY27489.1"
FT                   /translation="MKVSLLAACIIVFSATAQAATDGEHIYKQTCSSCHGRLADRKGLD
FT                   KAPPLISLSRNAIVEGLTARRDGKIVGRGNKAKAHLTDDDIQKLADHIESLKEAKSKVP
FT                   "
FT   CDS             727305..728174
FT                   /transl_table=11
FT                   /locus_tag="Y11_06931"
FT                   /product="tellurite resistance protein TehB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06931"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27488"
FT                   /db_xref="GOA:E7B9I0"
FT                   /db_xref="InterPro:IPR004537"
FT                   /db_xref="InterPro:IPR014431"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9I0"
FT                   /protein_id="CBY27488.1"
FT                   /translation="MENTSALLCYKQLPVWNSAGVPAMFREKHNTKAETWAKLTILSGE
FT                   MDFLILDEAGNTLERHSFSCENQPPFIEPQVWHRIAACSDDLQCQLSFYCMAEDFYHKK
FT                   YNLTPTHSEVIEAVKTVKPGKALDLGCGSGRNSLYLNLLGFDVTAVDKNGDSISHLQQI
FT                   IEQEKRLNITANTYNINEASLDNRYDFILSTVVLMFLQPERIPYIINNMQKCTLPGGYN
FT                   LIISAMSTDDFPCTVPFSFTLKSGELRHYYKDWDIIKYNEDVGQLHKTDAQGNRIKLRF
FT                   ATLLAKKP"
FT   CDS             complement(728225..729157)
FT                   /transl_table=11
FT                   /locus_tag="Y11_06941"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06941"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27487"
FT                   /db_xref="GOA:E7B9H9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H9"
FT                   /protein_id="CBY27487.1"
FT                   /translation="MSTNLPLALLSEMAIFVKVVETGSFSAVARQLGVSPSAISRSVSR
FT                   LEKALATRLLQRTTRKLRLSESGEEVFKRCNAMLNAANSVMEISGQYSQEPEGLIRVSV
FT                   PKAVGRFVVHPHIPEFLQRYSKIDVQLILDDRYVDFIDENVDLVIRITNHPPPGMVGRQ
FT                   LMNIEHLLCATPEYLSAQGTPLYPHDLAQHSCIYLGETPGDARWKFRQGTKAITVAVKG
FT                   RYAANHTGVRLDAVLQHIGIGSLPYFTARTALQQGQLVQVLPEWRFISSYSGGLWLIYP
FT                   PTRYLPAKLRVFIDYIVGRLRDEPDLPPR"
FT   CDS             729247..729873
FT                   /transl_table=11
FT                   /locus_tag="Y11_06951"
FT                   /product="metal-dependent hydrolase related to alanyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06951"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27486"
FT                   /db_xref="GOA:E7B9H8"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H8"
FT                   /protein_id="CBY27486.1"
FT                   /translation="MTTRLFFESDTLTMDVDVLSCAPDGEEFAVILLATIFHPQGGGQP
FT                   SDTGYIGNNQVLRVVQQQEQLIHYLTKSIAPGTYYARVDNERRLLNTRMHSAGHLIGNI
FT                   GEGYGWRPVKAHHWPGEGRVSFKRTQNPQVLDIDIIQAALEQFIRQDLPRQISVQGNFR
FT                   EVGFGELSAYACGGTHVGSLHELGKVTVQSISEKKGVMSVNYRVD"
FT   CDS             730031..730801
FT                   /transl_table=11
FT                   /locus_tag="Y11_06961"
FT                   /product="ferric reductase (1.6.99.14)"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06961"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27485"
FT                   /db_xref="GOA:E7B9H7"
FT                   /db_xref="InterPro:IPR008090"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H7"
FT                   /protein_id="CBY27485.1"
FT                   /translation="MANAAEVIYPSTTTAISDEIASLFACTFVHFSESFYVDAVEIPKD
FT                   SVLLEQWSAENSLPALMQNYENHYYSDTRLNPNHKALHSLWGQWYFGLVIPPMILMLLA
FT                   LPATINTRPERVRIKFHATGRPEAIYYQHDWLDKSPLSLLQRLYLLLDHHIIPVMKRIE
FT                   RQPRANTRLIWNNIGYLMFWYLREFANKLGPIEGYDAIIENLFLTSNLPDGRENPLYRT
FT                   VIPRNGGMERRTCCQRNKLPGVGSCLDCPLESRP"
FT   CDS             730852..732069
FT                   /transl_table=11
FT                   /locus_tag="Y11_06971"
FT                   /product="similar to a proline peptidase protein in
FT                   Bacillus subtilis O31689"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06971"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27484"
FT                   /db_xref="GOA:E7B9H6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H6"
FT                   /protein_id="CBY27484.1"
FT                   /translation="MNKEKIAHLNAVSRKARTLMEREGLDALVVTVCDNFYYLTGFASF
FT                   FMYTFRHTGAAVAIMFRDESIPSQIIMNEFEAASTHFDMPNMELKTFPVWVDVDDPRNP
FT                   LNHQKKRERPIGPPIEAVFGLVKDGLESAGVLDKAIAIELQAMSNGGKSVLDKVAPGLK
FT                   LVDSTALFNEIRMIKSPWEIQHLRKSAEITEFGIASAAKHIRVGCTAAELTAAFKAAVM
FT                   TFPETNFSRFNLISAGDNFSPKMFPDETPAKPGDLIKFDCGVDVAGYGADLARTFVLGE
FT                   PDELTQQIYNTIRIGHEHMLSMVAPGVKLKDVFDSTMDVIKKTGLPHYHRGHLGHGDGV
FT                   FLGLEEAPFVSTLATETFRPGMVLSLETPYYGIGIGSIMLEDMILITNDGYEFLSKLDR
FT                   DLRRYN"
FT   CDS             732748..733854
FT                   /transl_table=11
FT                   /locus_tag="Y11_06981"
FT                   /product="biofilm PGA outer membrane secretin PgaA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06981"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27483"
FT                   /db_xref="GOA:E7B9H5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H5"
FT                   /protein_id="CBY27483.1"
FT                   /translation="MYNAFTTLLRPLHRHRITLLALLISGLSVNPALAETQYDSLIIKA
FT                   RAGDTAPVLDYLQKESKAGPLNSGQVDDWLQIAGWAGRDQEVIDVYERYHSSVNLSSRG
FT                   LASAARAYRNEKRWDQALALWQSSLKKDPTNPDLITGMIRTQADSGRGGAALQQAKELA
FT                   ERNPSAQNYMTLSYLSRATNRNYDALQASSEAVRLAPESEEVLKNHLEILQRNRIADPA
FT                   LQLARENPKLVTAEQYRQLERDAAAEQVRMAVLPTRSETERFYIADQALADYQDLLARW
FT                   SKDPDAQADYQRARIDRLGALLVRRNTEELIKEYESMEAEGYKMPDYARRWAASAYIDR
FT                   RMPEKAAPILTSLYYADGKTFRMISITR"
FT   CDS             733851..735191
FT                   /transl_table=11
FT                   /locus_tag="Y11_06991"
FT                   /product="biofilm PGA outer membrane secretin PgaA"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_06991"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27482"
FT                   /db_xref="GOA:E7B9H4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H4"
FT                   /protein_id="CBY27482.1"
FT                   /translation="MNESEQLDKAHQFAKNYSEQTPYQVGVYGLPGKEPNDDWMEGQTL
FT                   LVQSLVALNDLPAAQKKLETLSSTAPANQNLRIALASVYLARDLPRKAEQELKAVESLA
FT                   PRSLILERAQAETAMDLQEWRQMELLTDDVIARSPEDVPSQELDRQRKVHNMYELRISS
FT                   NRTLSSNSPVSGNKDYGVETLLYSPPIADNWRVFGGGDYNNAQFEEGKGINRIMRLGGE
FT                   WTSRDVWAEAEVNNQNYGFGNKTGFRLASWYDFNDHWRVGGQVERLAKDTPLRAMRNNI
FT                   TANSASAFVLWKSDDRRDVEFNVTPSDYSDGNKRWEYELNGRQRIWTGPYLTADFNLGL
FT                   AASTNTKEDVIYYNPKRDFTYLPAVTLNHIMYRHYKTIWSQQVQLGVGGYWEKNYGNGL
FT                   VTTASYGQRVQWNDVVDTGLAVTYDKRPYDGVREHDLSLAFDLNYRF"
FT   CDS             735245..737227
FT                   /transl_table=11
FT                   /locus_tag="Y11_07001"
FT                   /product="biofilm PGA synthesis deacetylase PgaB"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07001"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27481"
FT                   /db_xref="GOA:E7B9H3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023854"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H3"
FT                   /protein_id="CBY27481.1"
FT                   /translation="MITLLASVCYAEKPVFVPPAERALPLSERPWQKNTFVVIAYHDVE
FT                   AESADQRYLSVRSSALSEQLAWLKDNRYNVVSVDQILAAHNGGTPLPNKAVLLTFDDGY
FT                   SSFYNRVYPFLEANNLSAVLAPVGTWIDTPPNKKVDFGGLSTDRDRFLTWKQITEMSKS
FT                   KLIEIGAHTYASHYGVIANPQGNTEPAAANLIYDPKTKKYETEAAFKQRMEKDISLITE
FT                   RIIKATGKQPRVWVWPYGAPNGTVLNILRQHGYQMAMTLEPGIGNVNDLMNIPRILISN
FT                   NPSLKDFAQLVTSVQEKDIMRVAHVDLDYLYDPDPAQEKENLDKLVQRISDLRVTTVFL
FT                   QAFSDPKGDGNIRQVYFPNRWIPMRQDLFNRVAWQLASRPDVDVYAWMPVLAFEMDSSL
FT                   PRIQRIDPKTGKTSIDPDQYRRLSPFNPEVRQRIIDIYRDMAYSAPIDGILYHDDAVMS
FT                   DFEDASPDAIRAYEKAGFPGSIAEIRKDPETMARWTRYKSKYLVDFTNELTRQVRDIRG
FT                   PQVKSARNIFAMPILEPESEAWFAQNLDDFLANYDWVAPMAMPLMEKVPLSESNEWLAQ
FT                   LVNKVAQRPGALNKTVFELQSKDWTKPEGSNAISGPILAGWMRQLQLNGAQNFGYYPDN
FT                   FITGEPPLKDVRPVLSSAWYPLYDR"
FT   CDS             737217..738551
FT                   /transl_table=11
FT                   /locus_tag="Y11_07011"
FT                   /product="biofilm PGA synthesis N-glycosyltransferase PgaC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07011"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27480"
FT                   /db_xref="GOA:E7B9H2"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H2"
FT                   /protein_id="CBY27480.1"
FT                   /translation="MIDRIIALLILCLVLSIPAGMILLFTGDVLLNFVFFYPLFMSGIW
FT                   ITGGVYFWLKRERHWPWGDDVPPPELKGNPLVSILIPCFNEGLNARETIHAALAQTYTN
FT                   IEVIAINDGSSDDTAQVLDALLAEDPRLRVIHLAHNQGKAIALRMGAAAARSEYLVCID
FT                   GDALLDSKAVPYLVAPLIANPRTGAVTGNPRIRTRSTLIGRVQVGEFSSIIGLIKRTQR
FT                   VYGQVFTVSGVVAAFRRRALADVGYWSPDMITEDIDISWKLQIRHWSVFFEPRGLCWIL
FT                   MPETLGGLWKQRLRWAQGGAEVFLKNMFKLWRWRNRRMWLLFLEYSLSITWAFTYLFSI
FT                   ILFLLGLVITLPPGIHVQTVFPPAFTGMVLALTCLLQFAISLVIERRYEPKLGNSLFWI
FT                   IWYPMVYWMLSLFTTVVSFPKVMLNTKRKRARWVSPDRGIGRVKP"
FT   CDS             738548..739015
FT                   /transl_table=11
FT                   /locus_tag="Y11_07021"
FT                   /product="biofilm PGA synthesis auxiliary protein PgaD"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07021"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27479"
FT                   /db_xref="GOA:E7B9H1"
FT                   /db_xref="InterPro:IPR023829"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H1"
FT                   /protein_id="CBY27479.1"
FT                   /translation="MSAPLIHTEQRLLPRLIDIIITALAWFGFIFLFVKGFLDMIHRAP
FT                   NMGPIPFRMYILAGLTTLALYAAIAAFNAIVLIVWAKYNQIRFQVERRGHRPHLGDDEL
FT                   ADSMEMTGEMIAQLKAGACLTLYNDEHGQLLEVKEGLQLPEVAPVVNLRRG"
FT   CDS             739231..739938
FT                   /transl_table=11
FT                   /locus_tag="Y11_07031"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07031"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27478"
FT                   /db_xref="GOA:E7B9H0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9H0"
FT                   /protein_id="CBY27478.1"
FT                   /translation="MNQNPFGQIIGAELPQWQSALRPQREILPGHFCYLAPVDSDKHEA
FT                   SLYQVYHLIPDASDWTYFYCERPESENDFQQYLQTLINAKDALHYTVMDAQADVALGTV
FT                   GLQRIDEKNGVIEIGSVNWSPRLKRNSAGTEAIYLLLHYVFDKLGYRRCEWKCDSLNGP
FT                   SNAAAMRFGFQYEGQFRQAVVTKGRNRDTNWYSITDREWPLIKQAFNDWLAMGNFDSQG
FT                   KQKTRLQDLRISR"
FT   CDS             complement(740361..740492)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07041"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27477"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G9"
FT                   /protein_id="CBY27477.1"
FT                   /translation="MITAFCLPIVAPFSLIQLPQQESLRDYVSHTDAVLASFAANNS"
FT   CDS             740467..741255
FT                   /transl_table=11
FT                   /locus_tag="Y11_07051"
FT                   /product="phosphate starvation-inducible protein
FT                   PhoH,predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07051"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27476"
FT                   /db_xref="GOA:E7B9G8"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G8"
FT                   /protein_id="CBY27476.1"
FT                   /translation="MGRQKAVIKARREAKRVIRRDSRSHRQREEENVTSLVQMGGVESI
FT                   GMARDSRDTSVIQARTEAQGHYLSAIESKLLIFATGEAGCGKTFISAAKAAEALIHKEV
FT                   DRIIVTRPVLQADEDLGFLPGDISEKFAPYFRPVYDILLRRLGSSFMQYCLRPEIGKVE
FT                   IAPFAYMRGRTFENAAVILDEAQNVTASQMKMFLTRLGENVTVIVNGDITQCDLPRGVK
FT                   SGLSDVLERFAEDEMIGIIRFDKQDCVRSALCQHTLNAYS"
FT   CDS             complement(741397..742833)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07061"
FT                   /db_xref="EnsemblGenomes-Tr:CBY26501"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E7B3U7"
FT                   /protein_id="CBY26501.1"
FT                   /translation="MLKDASPQQYHFETITLDELVPEDHLVRQIDAAIDFEFIRNAVAH
FT                   LYCPDNGRPAVDPVRLIKMMLLGYLFGVPSERRLVKEIQVNVAYRWFLRMGLTEKVPDA
FT                   STLSQNRIRRFNGSDVFQQIFDHIVEQALAQGMANGRVLYTDSTHLKASANPRKAVNEL
FT                   RPEGVSEYIDQLNAAVEADRKKHEKKPLPGVKKTPESAAALKNTKVSTTDPESGFMHRE
FT                   GKPKGFFWLDHRTVDGKHGIITDTHVTPGNVHDSQPFITRLTRQVERFSLDTVAVGVDA
FT                   GYFTSAVCHLTQEMGVALVPGYRRPHKGQNDYQKKHFRYDPAQELYICPAGSELSYGTT
FT                   DRNGYRHYRSDKAVCAGCPERSKCTKNRQMQKTITRHVWEEAKEKANALRLTKWGKKVY
FT                   ARRKETVERSFADAKQHHGHRYARFRGLMKVQMQCLLAATAQNMKKMALLAHLCWLFSM
FT                   TGTLIRGYVARRLLLKALAG"
FT   CDS             742801..742944
FT                   /transl_table=11
FT                   /locus_tag="Y11_07071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07071"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27474"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G6"
FT                   /protein_id="CBY27474.1"
FT                   /translation="MVLLWGGVFKHGGQSVFCTDLIRSKSRPKGQDFVSSLRAPFGCLR
FT                   HY"
FT   CDS             complement(742957..744687)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07081"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07081"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27473"
FT                   /db_xref="GOA:E7B9G5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G5"
FT                   /protein_id="CBY27473.1"
FT                   /translation="MNIQALLSDKVSQALIAAGAPAGSEPQVRQSAKAQFGDYQANGVM
FT                   AVAKKLGMQPRQLAEKVIELLDLDGIARKVEIAGPGFINIFLDRQWVASKVEEALKAPK
FT                   LGVQPVEPQTIVVDYSAPNVAKQMHVGHLRSTIIGDAAVRTLEFLGHNVIRANHVGDWG
FT                   TQFGMLIAYLEKMQNENASDMGLSDLELFYQQAKKTYDEDEEFAKRARAYVVKLQSGDE
FT                   YCRQMWRKLVDITMAQNQISYDRLNVTLTKDDVMGESLYNTMLPEIVADLKAKGLAVES
FT                   EGATVVYLDEYKNKDGEPMGVIIQKKDGGYLYTTTDIACAKYRYETLGADRVLYYIDSR
FT                   QHQHLMQAWTIVRKAGYVPESVPLEHHMFGMMLGKDGKPFKTRSGGTVKLSDLLDEAIE
FT                   RAGKLIAEKNPDMPADELKQVVEAVGIGAVKYADLSKSRTTDYIFDWDNMLALDGNTAP
FT                   YMQYAYTRVVSVFKRAGVDESNLILPLVITEDREAALATRLLQFEEVITTVAREGIPHV
FT                   MCSYLYDLAGLFSSFYEHCQILNADSEESRQSRLKLAMLTAKTLKQGLDTLGIQTVERM
FT                   "
FT   CDS             745055..745615
FT                   /transl_table=11
FT                   /locus_tag="Y11_07091"
FT                   /product="protein yecM"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07091"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27472"
FT                   /db_xref="InterPro:IPR010393"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G4"
FT                   /protein_id="CBY27472.1"
FT                   /translation="MSSLKDIVELSDLLTDLPYFAQKLVVFAAKLNLDLTQFSADHISL
FT                   RCHQTETAQRWRSGLQQCGNLMSETQINGRVICLFDLAPPLVVGPWQIDCVELPYPGKT
FT                   YYPHEGWEHVELVLPGNPQTLMQRARALLPTTLPEGVTTKFSSPQGEHERLANPTFAVS
FT                   DGEITIKFHPYTLRQIVDSERNG"
FT   CDS             745857..746621
FT                   /transl_table=11
FT                   /locus_tag="Y11_07101"
FT                   /product="cytoplasmic copper homeostasis protein cutC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07101"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27471"
FT                   /db_xref="GOA:E7B9G3"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G3"
FT                   /protein_id="CBY27471.1"
FT                   /translation="MTKLEICCYSVDCAQIAEKAGADRIELCCGQSEGGLTPSIGALMQ
FT                   ARETVTIPVHPIVRPRGGDFCYSDNDFAIIKNDIARIRDMGFAGVVVGVLDIDGHIDMR
FT                   RMREIMSVSGSLAVTFHRAFDMCQNPMIALQQLADLNVARILTSGQQQNAELGLALLKD
FT                   LVAATQGQGPIIMAGAGVRLTNMQKFIDAGIRELHSSAGRTVPSTMKYRKAGVTMCADS
FT                   DVDEFAHYCVDGEVVEAMKSLLVMSAPLPQSA"
FT   CDS             complement(746805..746921)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07111"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27470"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G2"
FT                   /protein_id="CBY27470.1"
FT                   /translation="MGVGTGLHHHSGDGTIGEELGKLLAGKLLRNRALPCLS"
FT   CDS             746925..747107
FT                   /transl_table=11
FT                   /locus_tag="Y11_07121"
FT                   /product="transposase for insertion sequence element
FT                   IS1328"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07121"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27469"
FT                   /db_xref="GOA:E7B9G1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G1"
FT                   /protein_id="CBY27469.1"
FT                   /translation="MARKIQQPGHQVKLSSPQFVRPFVKSNKNDFVDAEAICEAASRPS
FT                   MRFVQPKNEAHGCPA"
FT   CDS             747111..747410
FT                   /transl_table=11
FT                   /locus_tag="Y11_07131"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07131"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27468"
FT                   /db_xref="GOA:E7B9G0"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9G0"
FT                   /protein_id="CBY27468.1"
FT                   /translation="MAADKVGQNLLSIPAIGAITASLLASEIGDGKPFASSRDFAASIG
FT                   LVPRQYSTGGKTTLMGISKRGNKNLRRLLVQCARVFMLRLENNPGRLADWVKEL"
FT   CDS             complement(747787..747912)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07141"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27030"
FT                   /db_xref="UniProtKB/TrEMBL:E7B6S4"
FT                   /protein_id="CBY27030.1"
FT                   /translation="MVGLLKSIRRPMGTGSRATMRAAPDEPKKTLGFNEPFLWSG"
FT   CDS             complement(747993..748277)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07151"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07151"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27466"
FT                   /db_xref="GOA:E7B9F8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F8"
FT                   /protein_id="CBY27466.1"
FT                   /translation="MFVLLWIMHRNRIFCEIRQHWRHGIIGGAMQLLAYGIVIWAMKST
FT                   PIALVAALRETSVLFAMVISIWMLKEKPSILRLIASAIIMAGVAITKFG"
FT   CDS             748185..748301
FT                   /transl_table=11
FT                   /locus_tag="Y11_07161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07161"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27465"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F7"
FT                   /protein_id="CBY27465.1"
FT                   /translation="MHSTTNDAVTPMLPDFTKNSIPVHYPKQHKHGYPIGHK"
FT   CDS             748276..748518
FT                   /transl_table=11
FT                   /locus_tag="Y11_07171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07171"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27464"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F6"
FT                   /protein_id="CBY27464.1"
FT                   /translation="MAIPLDINSQKIVVEYYIDGDEYIRGQDGIPGYRIAGYEVYEHNA
FT                   EAKLAGFLEGKHITTPDADILLTILDDKPAEDLPS"
FT   CDS             748680..749720
FT                   /transl_table=11
FT                   /locus_tag="Y11_07181"
FT                   /product="mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07181"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27463"
FT                   /db_xref="GOA:E7B9F5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F5"
FT                   /protein_id="CBY27463.1"
FT                   /translation="MIAQFTMDNIVGLILVISCVIALLVVSVWGMRRHHSRYSFILQFV
FT                   SFLLCSVMVMVMGNIINNALADIKISFITPKTVNFVCMSAILLMLIRKMFVLFDVLEKR
FT                   QVAKGSDITSAKIIARMLKITLVVVVVLLYGEHLGMSFSGLVTFGGIGGLAVGMAGKDI
FT                   LSNFFSGVMLYFDRPFNIGDWIRLPDRHIEGVVVEIGWRLTKIMTFENRPLYVPNSAFT
FT                   DTSVENPGRMTNRRIKTTLALRYEDADKIGTIVDEMHKFLANNNDIDHQQTLLVYFNGF
FT                   GESSLNIMVYCFTKTRVWAEWLAVQQACYLKFIDIVHQHGADFAFPSRTLYVEDSTESP
FT                   FTPAEQ"
FT   CDS             749941..750543
FT                   /transl_table=11
FT                   /locus_tag="Y11_07191"
FT                   /product="putative glutathione S-transferase,YfcF homolog"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07191"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27462"
FT                   /db_xref="GOA:E7B9F4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F4"
FT                   /protein_id="CBY27462.1"
FT                   /translation="MDFFSPYVMSVYVSLTEKALPFTLRTIDLSAGENLREEFGKLSAT
FT                   RRVPTLTIDNFRLSESSAISEYLEERFPSPEYARIYPQDRQERAKAREIQAWLRSDFMP
FT                   IRAERPTEVVFAGMKMPLLSDQGQQAAHKLISGLERLLSDGRKNLFSEWCIADTDLALM
FT                   LNRLVLNGDELPGYLSKYASYQWQRPSVQRWCTLSQK"
FT   CDS             750612..751160
FT                   /transl_table=11
FT                   /locus_tag="Y11_07201"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07201"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27461"
FT                   /db_xref="GOA:E7B9F3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F3"
FT                   /protein_id="CBY27461.1"
FT                   /translation="MIEVETERLRLRQWIPSDKAPFAALNADKRVMEYFPAPLTREESD
FT                   AMASRCQRLIEQHGWGLWAVELKATKQFVGALGLHILAAKLPFSPCVEIGWRFAYPFWG
FT                   QGLATEAALAALQVGFARLKLPKIVSFTALINLRSQAVMERIGMVRAPESFPHPNVSAD
FT                   SPLSQHCWYYLTSHQWHSR"
FT   CDS             751145..751270
FT                   /transl_table=11
FT                   /locus_tag="Y11_07211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07211"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27460"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F2"
FT                   /protein_id="CBY27460.1"
FT                   /translation="MAQSLGVIDIKAQNFDSVKRRGYNYIKSSRGSEPSTTAAVI"
FT   CDS             751661..751894
FT                   /transl_table=11
FT                   /locus_tag="Y11_07221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07221"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27459"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F1"
FT                   /protein_id="CBY27459.1"
FT                   /translation="MKKVSIIAQCLMDAKSFSEMSEAESSIKKIFNDSHADHSFDEWNT
FT                   DVSTLSAKRIISQVANASKVRVRGLIQELWNY"
FT   CDS             752197..752319
FT                   /transl_table=11
FT                   /locus_tag="Y11_07231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07231"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27458"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9F0"
FT                   /protein_id="CBY27458.1"
FT                   /translation="MKIKCPDCGATSEQSTEKVHKNTALVCPKCGCLFLPKDKH"
FT   CDS             752575..753006
FT                   /transl_table=11
FT                   /locus_tag="Y11_07241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07241"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27457"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E9"
FT                   /protein_id="CBY27457.1"
FT                   /translation="MRCINNITIRNNETMAAIPQKYENAERWAFGDTEQVADDLLALVL
FT                   NGTKTATCAALDDEGVPQAGDVFVVVNGRNEPVCAVELTDVELQTFDQVDEAHALAEGE
FT                   GDRTLAYWRKTQQRFFEEYELFSPDMMLICMRFKVLEIF"
FT   CDS             complement(753124..753366)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07251"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27456"
FT                   /db_xref="InterPro:IPR009950"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E8"
FT                   /protein_id="CBY27456.1"
FT                   /translation="MGNTVVKIRDFEVDDAVLSAPVDKGENTVSIPCKSDPELCMQLDG
FT                   WDESTSIPATLDGQDKLLYKKHYDRHQDAWVMRVT"
FT   CDS             complement(753479..755002)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07261"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27455"
FT                   /db_xref="GOA:E7B9E7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E7"
FT                   /protein_id="CBY27455.1"
FT                   /translation="MTDYDNREKSADIALLKEMNSLRDIIENNSDWIWEVDVTGRYTFS
FT                   SAKSIELLGRLPHEVIGKTPFDFMPKDEAHRVGKLFAEIAAERIPFAGLQNRNIRADGS
FT                   EVLIESSGIPLFDHNGEFKGYRGIDRNLSNLPYNASQRLFELESIYSSAPAGLCFIDTA
FT                   LHYLTVNDYLAELLGKKTVEVNGHKVADFLPGIIPILQSALLKAYCNDSIPDAEFQMPD
FT                   KQRVFFMRINAARYPSGQVSGLSVAMIDISALKKMEEKLRSSKQHYRNMVELNPQIPWT
FT                   ASPDGMITNVSSRFEKITGLTREEALADRWLRTIHADDRHPTLISWEHSLQTHDPLDVE
FT                   IRFCHVEKGWNWMRIRAVPSVDEHGNVECWYGTAEDIHERKLLELKLIKANRRLEIQAR
FT                   TDSLTKLPNRREFKKVLAHEFMRARRSASPLAVLMVAEHILQSIRAMGIKHSESKFRKV
FT                   TISLGVTVYQSHLHSSITDQSDLMLAADQALYYSKKNGRNQFNLAELPC"
FT   CDS             complement(755225..756235)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07271"
FT                   /product="sigma-fimbriae tip adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07271"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27454"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E6"
FT                   /protein_id="CBY27454.1"
FT                   /translation="MTPNNIRISLVASHLGIIALLILLIGLIAPPAQADSCTFSPGTVT
FT                   LPPSSSVTAGTTAVNAQGTTAMTCPGALISITLLGSFTLSATISGTTNNLNLKNEVGDL
FT                   IPYSIYRTGTFSPALPIGGKLDYASSSLLSISLGSLNANLPIYIRTGNNGVISTNISAG
FT                   TYTDVINLAWNYNICKVLNVLGGCVGSWVGSGTGTDISSVTVTLVVSKDCAINSASDVN
FT                   FGSFALVGQFNPISQNITLTCTKGTTFNTYVTPGDNPVTNWRQMKLNSTTVTNYLQYQL
FT                   YQGTSGTTLWDASSMQSGSGTGAAQLVPFHAVINPNQNQRTPGDYRDNVSLVLVY"
FT   CDS             complement(756266..758656)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07281"
FT                   /product="sigma-fimbriae usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07281"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27453"
FT                   /db_xref="GOA:E7B9E5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E5"
FT                   /protein_id="CBY27453.1"
FT                   /translation="MISPAFIPLTVRGNDLPPPPSAAVMPDTTLYLELVVNGRNFGEAV
FT                   PVIYRDGHYYLTPEQLKTVGFPAPSPNTPEVAIDVMDKVHVTYQGDSQKLLIDVPSEWL
FT                   PQQRVNTAATEDYNLAQSSLGLLFNYDIYASQGNSSGQPSNASAWTEQRLFDHFGLISN
FT                   TGIYRSNLTDTDNVTVEKGYVRYDTQWRLNDENHLLSYSAGDLITGSLAWSSSVRVGGF
FT                   QVSRNFAIRPDLVTYPLPQFAGQAAIPSTVDLYIDNFRTQSASVNPGPFVIDNGPRING
FT                   AGQATVVTTDALGRQVSTSIPFYVASDLLKPGLWDFSISSGMLRQNYGIRSADYGEPVA
FT                   SGVLRYGTTPWLTLEGRTDIAKQLNVVGSGVSLRVGNYGVVNSSYTISNAGDAVLGSGI
FT                   APTETDISPPPPSSSLRYGGRGNQYSLGYSYSNAFFSLNAQRINRSQNYGDLANYKSEY
FT                   RPSRRTDQITSSLGLGAYGSIGSGYFDVRDALGERTRLVNISYNTTLWHNTSVYFSLNR
FT                   ELGSKGYNAQMVLSIPLGDWGAGSISSARDTNNNWSQRVNYSRATPTNGGFGWNLAYAN
FT                   GTGENSRYQQADLIWRTRALESRVGVYGSQGDYQSWGEVSGSLVVMNNGVYASNTINDA
FT                   FALISTHGFGQIPVSYENQLIGTTNDDGYLLVPNVTSYYQAKFQIDPMSLPADVSMPEV
FT                   ERRLAISERSGYLIDFPLEQITSATLRITDESGKDLPKGSPVFTSETKPVSYVGWDGIT
FT                   YIEQAKPQNKLKIIRADNGARCYLQFALKASTGIQDIGTVTCK"
FT   CDS             complement(758794..759543)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07291"
FT                   /product="sigma-fimbriae chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07291"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27452"
FT                   /db_xref="GOA:E7B9E4"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E4"
FT                   /protein_id="CBY27452.1"
FT                   /translation="MIKLTSLASLVLFATAVASSPLYAASSVLIWPIDPVINSHEKATA
FT                   LWLENKDSQPVYMQIRVLGWQQKSGQEDYSNQSAIIASPPVATILPGKRQLIRLIKNTQ
FT                   VPAGQEQAFRVLIDEIPRKDPNEDAAAPSLNMGLKFQMRYSIPLFIYGDGLKPEDANNP
FT                   ATFFPLSLSYKLVQDSGKTWLAIRNQGQTHARISQVNLQNTSLNSGLMGYVLPGNEMRF
FT                   QVPASANSGQLTALVNSHTKPVVIPHQ"
FT   CDS             complement(759590..760147)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07301"
FT                   /product="sigma-fimbriae uncharacterized subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07301"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27451"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E3"
FT                   /protein_id="CBY27451.1"
FT                   /translation="MTLNSFYPTVITLLVFSLLGLPVTSSYGETLNRAFTVNATILSGC
FT                   ILGSGNSDSSSFGALNFGNVSSLSTAINIVSSQNAGSIMIQCSGTPSITLALNSGANTT
FT                   GNIATGRRLLNSATGEYLFYQIFQDSARSVIWGNGSNGGTAQVITANSTLQQIVLYAQL
FT                   FASSSFPTAGNYTDTLLVTVTY"
FT   CDS             complement(760159..760716)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07311"
FT                   /product="sigma-fimbriae uncharacterized paralogous
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07311"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27450"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E2"
FT                   /protein_id="CBY27450.1"
FT                   /translation="MVLGITPDNFRINIDKTVLLGFIFSLLLLRTYPVDAVSKMANITV
FT                   NATLLPTCIAGTTTAGATTFGTLNFGSVTVLNRPISIIGQANSGAISVQCSKNTSFTVL
FT                   LSAGQSGSVNNRYLVGGANNQHVNYNLYTDAAHSHIWDNTVGISQVASGQPVTLPVYGL
FT                   IPIQSTPSVGIYTDTIQVTVNW"
FT   CDS             complement(760722..761258)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07321"
FT                   /product="sigma-fimbriae uncharacterized paralogous
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07321"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27449"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E1"
FT                   /protein_id="CBY27449.1"
FT                   /translation="MKKTLLILGAMVLLQSAPPIASAASVAGTLGATLTIITGCYINDG
FT                   TNSGGISNLGTINFGTVSTLNTRIRQAYSSTANGALNLYCSAGTTYNIGIDNGAHALTT
FT                   QRRLAGGTTEYVNYNLYKDNGYSQPWGSTGSDQLTGTAAAIGTAIPLTIYGEVPTQATP
FT                   SVSTYIDTVNVTVSW"
FT   CDS             complement(761584..763008)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07331"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07331"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27448"
FT                   /db_xref="GOA:E7B9E0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9E0"
FT                   /protein_id="CBY27448.1"
FT                   /translation="MKANTRNINSLKVEDTNLRKTVLSLSLPMLLSSLATSIANVGLPT
FT                   LTQALNASFQDAQWVVLAYLLAITTSAISIGRMGDIIDKRLLLKTGIGLFTVASVGCAL
FT                   APTMGILIAARVIQGLGAAAMMTLTLALVGETVSPEKTGRVMGMLGTVSALGTALGPSL
FT                   GDILIAGFGWPAIFLINIPLGLLALLLISRYLPCNRTAFTQPQSGFDPIGMLLLGLTLA
FT                   LYALSMTWGHGRFDARNLALLAAAAIGVGLFSRAEKRAKYPLIQTAMLRHSVLRGSLIM
FT                   STLVTTIMMSTLIVGPFYLSRGLGLPAQWVGLAMSAGPIVAALGGIPAGYAVDKLGAQI
FT                   MVTGGLVGVTFGATILAIIPTGWGVLGYVVPVCLITASYAIFQTANNTLMIKSVGADQR
FT                   GVVSGMLNLSRNLGLITGASVMGAIFAFASTAQNIQLATTTDIIQGMQLTYGVAALLAA
FT                   IALGISAIHLRNKFNQ"
FT   CDS             763137..764057
FT                   /transl_table=11
FT                   /locus_tag="Y11_07341"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07341"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27447"
FT                   /db_xref="GOA:E7B9D9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D9"
FT                   /protein_id="CBY27447.1"
FT                   /translation="MTKPDLNLLLTLNVLLAEGSVVRAAQRLGLSPSAMSRALARLRQT
FT                   TGDPLLVRAGRVLVPTPRALELREQVSQLVEGATSVLRPAEKLNLAQLTRIFTLRTSDG
FT                   FVENFGATLLARVNQDAAQVRLRFMQKMDKDSALLRDGIVDLETGVVGSSASPELRMRG
FT                   LFRDRFIGVVRARHSLCKGEISPERYASQGHIMISRRQGHKGPVDDALQLVGLERNAVT
FT                   YVDGISTALALVKGSDLVATVPERHTQNLRSGMFSFPLPITSPVIMISMLWHPRMEADP
FT                   AHRWLRQCVLDVCGDDHQGGITLPP"
FT   CDS             complement(764070..766700)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07351"
FT                   /product="paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07351"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27446"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D8"
FT                   /protein_id="CBY27446.1"
FT                   /translation="MQQETPSTPTEAQIKHKRRISPFWLLPFIALLIAGWLVYNNWQER
FT                   GTEVTIDFQSAAGIVAGRTPVRYQGVEVGMVQSISLDDDLRNIKVTASIKNDMEDSLRE
FT                   GTQFWLVTPKASLAGVSGLDALVGGNYIGMMPGEGKPQSHFTALDTQPKFRLNTGELMV
FT                   HLHAPDLGSLNNGSLVYYRKIPVGKVYDYNIAPDNNGVVIDVLIDRRFAKLVKNNTRFW
FT                   NVSGFKGDFSLNGASVQMESLAALVNGAIAFDSPPNSQNAKPDQPFQLYPDLAHSQRGV
FT                   AITLDLPGGNRLSEGRTPLIYQGLQVGTLTKMTLQPDGKVTGELTIDPSVVDLMRTGTR
FT                   IEMNSPRISLNDAKLSELLTGNTLELIPGEGEPQQRFTVLPSSKSLLQQPNVLELQLTA
FT                   PESYGIDVGQPISLHGIKIGQILTRELLANGVSFTAAIEAKYRNLVHKDSKFVVNSRLD
FT                   VKLGIDGIDVQGASAQEWIDGGILILPGSKGEPLGKYPLYSSVDKATDGILGNSPATTL
FT                   TLTATSLPDVQTGSVVLYRKFQVGEITQIRPNANEFEVDVYIQPEYRKLLTDKSIFWAE
FT                   GGAKVQLNGSGLTVQASPLNRALKGAISFDNLEGVTLDKGAKRTLYANETAARAVGSQI
FT                   ILRTFDASKLAAGMPIRYLGINIGQVESLKLAPERNEVLAKAVLYPEYVQSFARAGTRF
FT                   SIVSPEISAAGVNNLDTLFQPYINVEPGKGGTLRTFELQTATITDSRYLDGLSIILDTA
FT                   EAGSLQVGTPVLFRGLEVGTVTGFNLGAMSDRVQVSLRISQKYQQLVRQNSVFWLASGY
FT                   NLEFGLTGGVVKSGTFQQFIRGGIAFATPPTTPLAPKASVNQHFLLNPQEPKDWRDWGT
FT                   AIPHF"
FT   CDS             complement(766669..767916)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07361"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27445"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D7"
FT                   /protein_id="CBY27445.1"
FT                   /translation="MKIHAIQRPLSTSRVQRCCQCDALFTLPPLNGRQTAYCPRCSAKI
FT                   ASGRDWSLTRLTAIAVAMLLLMPFAFTEPLITIRLLGTRIDASLLEGIWQMSRQGHPIT
FT                   ASMVAFCILGAPITLTVSILYLRIGSRMGMNLRPILLMLERLKEWVMLDIYLIGMAVAC
FT                   IKVKEYADVMAGTGLIAYLTLTLLSILALVHLNLEQLWERFYPQEQPPGPRETLRVCLS
FT                   CHYTGHPDTLGRCPRCHIPLRHRRRHSIQKTWAALIASIVLLLPANLLPISIVYANGTR
FT                   MEDTIFSGVVSLASSGNLPIAAVVFIASVLVPFTKIIVLITLLMSIHLKTQHSLKTRMR
FT                   LLRLITWIGRWSMLDLFVIALMMSLINRDQLLSFTMGPAAFYFGSAVILTILAVEWLDS
FT                   RLIWDAHATGNAEYTD"
FT   CDS             768178..768675
FT                   /transl_table=11
FT                   /locus_tag="Y11_07371"
FT                   /product="gaf domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07371"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27444"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D6"
FT                   /protein_id="CBY27444.1"
FT                   /translation="MKKAEFYAELKRDLSALIAGETNFIATLANASALIYERLDGLNWA
FT                   GFYLLDGNQLVLGPFQGKIACVRIPVGKGVCGTAVAENRVQRVGDVHAFPGHIACDAAS
FT                   NAEIVLPITVQGKVIGVLDIDSIVYDRFDKDDELGLISVVAGLCEHLELCDSAKYVTQA
FT                   AS"
FT   CDS             768771..769499
FT                   /transl_table=11
FT                   /locus_tag="Y11_07381"
FT                   /product="proq: influences osmotic activation of compatible
FT                   solute ProP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07381"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27443"
FT                   /db_xref="GOA:E7B9D5"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D5"
FT                   /protein_id="CBY27443.1"
FT                   /translation="MENQPKLNSSKEVIAFLAERFPLCFTAEGEARPLKIGIFQDLVER
FT                   VQGEENLSKTQLRSALRLYTSSWRYLYGVKVGAERVDLDGNPCGVLEEQHVEHARKQLE
FT                   EAKARVQAQRAEQQAKKRETAIAAGETPEPRRPRPAGKKPAPRREAGVASENRKPRQSP
FT                   RPQQANQKQARPPRPQAEENQPRPVPVTDISKLQIGQEIKVRAGKSAMDATVLEIAKDG
FT                   VRVQLSSGLAMIVRAEHLQL"
FT   CDS             769519..771594
FT                   /transl_table=11
FT                   /locus_tag="Y11_07391"
FT                   /product="tail-specific protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07391"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27442"
FT                   /db_xref="GOA:E7B9D4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D4"
FT                   /protein_id="CBY27442.1"
FT                   /translation="MNKFVRLTAIAGLLLAGASYAADTTTYRIDQLPQLHQEPEHATVS
FT                   ERVTSRFTRSHYRQFALDDQFSAKIFDRYLNMLDYSHNVLLASDVAKFADKKHSLDDEL
FT                   KSGQLDTPYALFNLAQKRRFERYQYALSVLNRPMDFTGNDTIDIDRGKAPWPTSEAELN
FT                   KLWDAKVKYDQLNLKLTGKTDKEIKETLTKRYQAAIKRLTQSNSEDVFQLIMNAFAHEI
FT                   DPHTNYLSPRNTEQFNTEMSLSLEGIGAVLQMDDDYTLINSMVPGGPAAKSKTIAVGDR
FT                   VIGVGQTGKPMVDVIGWRLDDVVALIKGPKGSKVRLEILPAGKGTKPRTVTLTRERIRL
FT                   EDRAVKMSVKTIGKERVGVLDIPGFYVGLTEDVKVQLQKLEKQNVSSIIIDLRSNGGGA
FT                   LTEAVSLSGLFIPSGPVVQVRDNNGKVREDSDTDGVVYYKGPLVVLVDRYSASASEIFA
FT                   AAMQDYGRALIVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPALGSLQYTIQKFYRVDGG
FT                   STQRKGVTPDIVMPTGVDPAETGESFEDNALPWDSINAASYAKVGDLKPLEPELLKTHA
FT                   ARIAADPEFQHIQQDIERYKALKDKKNIVSLNYAQREKENHDDDATRLNRLNERFKREG
FT                   KKPLKSLEDLPKDYQEPDPYLDETVHIALDLAHKEKAQPQVESQPAVPAATATAAK"
FT   CDS             771889..772770
FT                   /transl_table=11
FT                   /locus_tag="Y11_07401"
FT                   /product="putative protease HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07401"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27441"
FT                   /db_xref="GOA:E7B9D3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D3"
FT                   /protein_id="CBY27441.1"
FT                   /translation="MMRIALFLLTNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFG
FT                   GAFVSLLMSKWMALRSVGGEVIEQPRNETERWLLDTVRRQSQQAGIAMPQVAIYQAPDI
FT                   NAFATGARRDASLVAVSTGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGIVNTFV
FT                   IFISRLIAQVAAGFLSGDRDNEGSSSGNPMVYFAVSMVLELVFGILASIITMWFSRHRE
FT                   FHADAGSARLVGREKMIAALQRLKTSYEPQEAGTLMAFCINGKSKSFSELFMSHPPLDK
FT                   RIEALRSGEYLK"
FT   CDS             772805..772930
FT                   /transl_table=11
FT                   /locus_tag="Y11_07411"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07411"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27440"
FT                   /db_xref="GOA:E7B9D2"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D2"
FT                   /protein_id="CBY27440.1"
FT                   /translation="MKGRTKRGGDETTLIDFISDSALLESILRIAKDEGRIDGPK"
FT   CDS             complement(772942..774321)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07421"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07421"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27439"
FT                   /db_xref="GOA:E7B9D1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D1"
FT                   /protein_id="CBY27439.1"
FT                   /translation="MTPAATDGMPVPQRYAAVVVIALGIMIAVLDGTIANVALPTIARD
FT                   LNASPATSIWVVNAYQLAITVSLLSMASLGDIIGYRRVYQAGLLVFSVTSLFCALSDSL
FT                   WTLTFARVLQGLGAAALMSVNTALIRIIYPKTQLGRGIGINALIVAVSAAAGPTIAAAV
FT                   LSVASWQWLFAINVPIGLVAWGLGMKFLPANNMKSNGNRFDVTSSIMNALTFGLLITAI
FT                   SGFAQEQSPTLIAAEVIALLVIGFFFVRRQLSQPFPLLPVDLLRIPIFALSIGTSVCSF
FT                   AAQMLAIVSLPFFLQTVLGRDEVATGLLLTPWPLATMVVAPIAGRLVERYHAGLLGGIG
FT                   LAVFASGLFLLAILPANPTDLDIICRMVLCGAGFGLFQAPNNHTIISAAPQQRSGGASG
FT                   MLGTARLLGQTSGAALVALMFNLFATNGTHASLILAGCFASFAALVSLLRVSQKAVSLN
FT                   N"
FT   CDS             774646..775812
FT                   /transl_table=11
FT                   /locus_tag="Y11_07431"
FT                   /product="oligogalacturonate lyase"
FT                   /EC_number="4.2.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07431"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27438"
FT                   /db_xref="GOA:E7B9D0"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027946"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9D0"
FT                   /protein_id="CBY27438.1"
FT                   /translation="MAKGKQIPLTFHTYQDASTGAQVTRLTPPDVTCHRNYFYQKCFTR
FT                   DGSKLLFGGAFDGPWNYYLLDLNTQVATQLTEGRGDNTFGGFLSPDDDALFYVKDGRNL
FT                   MRVDLATLEENVVYQVPDEWVGYGTWVANSDCTKLVGIEIRREDWVPLTDWKKFHEFYF
FT                   TKPCCRLMRVDLKTGESTVILQENQWLGHPIYRPYDDSTVAFCHEGPHDLVDARMWLIN
FT                   EDGTNMRKVKTHAEGESCTHEFWVPDGSALVYVSYLKGSPDRFIYSADPETLENRQLTS
FT                   MPACSHLMSNYDGSLMVGDGSDAPVDVQDDSGYKIENDPFLYVFNMKNGTQHRVARHDT
FT                   SWKVFEGDRQVTHPHPSFTPDDKQILFTSDVHGKPALYLATLPESVWK"
FT   CDS             775999..776790
FT                   /transl_table=11
FT                   /locus_tag="Y11_07441"
FT                   /product="transcriptional regulator KdgR, KDG operon
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07441"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27437"
FT                   /db_xref="GOA:E7B9C9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C9"
FT                   /protein_id="CBY27437.1"
FT                   /translation="MAIADLDKQPDSVSSVLKVFGILQALGEEREIGITELSQRVMMPK
FT                   STVYRFLQTMKSLGYVAQEGESEKYSLTLKLFELGAKALQNVDLIRSADIQMRELSNET
FT                   RETIHLGALDEDSIVYIHKIDSMYNLRMHSRIGRRNPLHSTAIGKVLLAWRDRGEVEEI
FT                   LSHIEFTRSTKHTLDSAAALLPVLDQVREQGFGEDVEEQEEGLRCIAVPVFDRFGVVIA
FT                   GLSISYPTLRFSEDSKSDIVKSLHRAARNISEQMGYRDYPF"
FT   CDS             777066..777917
FT                   /transl_table=11
FT                   /locus_tag="Y11_07451"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07451"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27436"
FT                   /db_xref="GOA:E7B9C8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C8"
FT                   /protein_id="CBY27436.1"
FT                   /translation="MRKLLSTGLLLLLAGCSSSHRDNPHQLIDRGEYKVDTSTPSIAQN
FT                   ERVRFLVLHYTATDDAESLRLLTQGDVSAHYLVKTYPESLNGKPVVLQLVPESQRAWHA
FT                   GVSYWQGRNNLNDTSIGIEIVNRGFTERMLRREWYAYNESQIELIERLTKDIVERYNID
FT                   PANVVAHSDIAPLRKSDPGPLFPWKRLAEQGIGAWPDDATVNKYINGRNMSGMASVTII
FT                   QQALARYGYQIPQSGELDNETKQVIKAFQMHFRAQNFSGIPDVETEAIALALVEKYRPL
FT                   HP"
FT   CDS             complement(778355..778489)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07461"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07461"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27435"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C7"
FT                   /protein_id="CBY27435.1"
FT                   /translation="MPWLYRLLNKKAYNVAVVAQANKTARILWSILVQHTEYRTLSAV"
FT   CDS             complement(778461..778628)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07471"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07471"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27434"
FT                   /db_xref="GOA:E7B9C6"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C6"
FT                   /protein_id="CBY27434.1"
FT                   /translation="MLPREFSSGGKQRLGRISKRSERYFRYLLAHGARAVAAVIERHKD
FT                   QYAVALQAVE"
FT   CDS             complement(778597..779388)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07481"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07481"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27433"
FT                   /db_xref="GOA:E7B9C5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C5"
FT                   /protein_id="CBY27433.1"
FT                   /translation="MLKLRRRSVHMKVSTLGIDLAKNVFQLHGVGCNGQTVLKKKLTRD
FT                   KFLPFLMQLEPCLIGMEACASSHHFARVLRQYGHEVKLIPPQYVKPYVKTNKTDAADAE
FT                   AICEAVARPNMRFVQIKTAEQQAILVLHTERNILIRERTACANSMRAILAEFGIIMPRT
FT                   LSQLYKKIPEILEEYDNELSPFVRCSVARQLEHLQGVEDQITLIEQNLAVGQNTTRLPA
FT                   GHENPREWDDDGDLTLWRQWGMGNNFNSAKQFAAERVLKWR"
FT   CDS             complement(779560..780228)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07491"
FT                   /product="L-cystine uptake protein TcyP"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07491"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27432"
FT                   /db_xref="GOA:E7B9C4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C4"
FT                   /protein_id="CBY27432.1"
FT                   /translation="MALMAKVVAGSNIQDIIKLGSFVVASYLGLAIMFVVHGVLLSFTG
FT                   INPLKFFRKVWPVLTFAFTSRSSAASIPLNVEAQTRRLGVPESIASFSASFGATIGQNG
FT                   CAGLYPAMLAVMVAPTVGINPLDPVWIATLVGIVTISSAGVAGVGGGATFAALIVLPAL
FT                   GLPVTLVALLISVEPLIDMGRTALNVSGSMTAGTITSQLMKQTDKDILNSDDDGDLAHQ
FT                   "
FT   CDS             complement(780447..780995)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07501"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27431"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="InterPro:IPR016956"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C3"
FT                   /protein_id="CBY27431.1"
FT                   /translation="MTGEGHLIFSVACVIFAKKVGLTPELAHGDWWHIIPGALLTSLLP
FT                   DIDHPKSILGQRLKWLSTPIARAFGHRGFTHSLLAVIGGIALFQMDISRDWIIPADVFH
FT                   AMIVGYFSHLLADMITPAGVPLLWPCRWRFTIPLLRPQKGNQLERVLCVLLVCFSVYWQ
FT                   TDTTIPLLSYMEQLKNFRL"
FT   CDS             complement(781353..782051)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07511"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07511"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27430"
FT                   /db_xref="InterPro:IPR009331"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C2"
FT                   /protein_id="CBY27430.1"
FT                   /translation="MKFKLLTLAVASVISFSSVATTIDYRHEMKDTSKSDHKDRLLISN
FT                   RFANGFGLSLEGKWGQHSSDTTPNKPFNEQVSNGTEVVASYVYQFNKTFQLEPGFSLES
FT                   SSDSNNYRPYLRGKVSFTDDFSTSLRYRPYYKRNQPAQTKATEKGHEFTMLFAYNFLKN
FT                   YSAEYELNYKKSEDEILANKEKEEWSHDLKVAYKWDKNWKPYVAIGNVAGSKTTDERQT
FT                   RYRVGVQYSF"
FT   CDS             782173..782346
FT                   /transl_table=11
FT                   /locus_tag="Y11_07521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07521"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27429"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C1"
FT                   /protein_id="CBY27429.1"
FT                   /translation="MHILFILLNIYVIQICLNDSFFKQILNCDVCLVGYYFMAIKQKNP
FT                   AKLMAGFNRYLS"
FT   CDS             complement(782361..783653)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07531"
FT                   /product="sugar-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07531"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27428"
FT                   /db_xref="GOA:E7B9C0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9C0"
FT                   /protein_id="CBY27428.1"
FT                   /translation="MKKAILHTLIASTLALLSHQAFAAQDEVNLRMSWWGGNGRHQVTL
FT                   KALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGF
FT                   YNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTW
FT                   DELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEAGKKFAYTPEQW
FT                   VEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLT
FT                   KPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALG
FT                   LERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDA
FT                   IQYIDYGQKTVQETAEYFNKQGDRILKRAMR"
FT   CDS             complement(783669..784796)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07541"
FT                   /product="ABC sugar transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07541"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27427"
FT                   /db_xref="GOA:E7B9B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B9"
FT                   /protein_id="CBY27427.1"
FT                   /translation="MAEVIFNKLGKVYSNGFRAVHGIDLKIHDGEFMVIVGPSGCAKST
FT                   TLRMLAGLETISDGEVRIGDRVVNNLAPKSRGIAMVFQNYALYPHMTVKENLAFGLKLS
FT                   KLPKDQIETQVAEAAKILELEDLLDRLPRQLSGGQAQRVAVGRAIVKKPDVFLFDEPLS
FT                   NLDAKLRASMRIRISDLHKQLKKSGKAATTVYVTHDQTEAMTMGDRICVMKLGHIMQVD
FT                   TPDNLYHYPTNMFVAGFIGAPEMNIKPSTLVEKEGKVGLTVGQYTLVLNERQQAKVAAH
FT                   AGEKVFFGVRPEFVSMSMNPFTDNHSQGELVRVENMGHEFFMYIKVDDFELTCRLPSDE
FT                   ARPIIENGLHRTVYFQFDMDKCHIFDAKTEKNISL"
FT   CDS             complement(784810..785727)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07551"
FT                   /product="putative sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07551"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27426"
FT                   /db_xref="GOA:E7B9B8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B8"
FT                   /protein_id="CBY27426.1"
FT                   /translation="MTDVQNSHQKKLDLAQDIADAEISRTLRKAKVSAIFRYVILIIVG
FT                   LMMLYPLLWMFSAAFKPNNEIFTTLGLWPEHPTRDGFVNGWKTGTEYNFGHYMLNTFKF
FT                   VIPKVILTIISSTIVAYGFARFEIPWKKFWFATLITTMLLPSTVLLIPQYIMFREMGML
FT                   NSYMPLYLPLAFATQGFFVFMLIQFLRGVPRDMEEAAQIDGCNSFQVLWYVVVPILKPA
FT                   IISVALFQFMWSMNDFIGPLIYVYSVDKYPIALALKMSIDVTEGAPWNEILAMASISIL
FT                   PSIIVFFLAQRYFVQGVTSSGIKG"
FT   CDS             complement(785720..786448)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07561"
FT                   /product="putative ABC sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07561"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27425"
FT                   /db_xref="GOA:E7B9B7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B7"
FT                   /protein_id="CBY27425.1"
FT                   /translation="MFLEDDLFWKSMGVTFAYVFLTIPLKLAFALGIAFVLNFKLRGIG
FT                   FFRTAFYIPSILGSSVAIAVLWRALFAIDGLLNGFIGVLGFDPVNWLGEPALALTSVTL
FT                   LRVWQFGSAMVIFLAALQNVPQSQYEAAMIDGASKWQMFMKVTVPLITPVIFFNFIMQT
FT                   TQAFQEFTAPYVITGGGPTHYTYLFSLYIYDTAFKYFDMGYGAALAWILFLVVALFASI
FT                   AFKSSKYWVFYSADKGGKND"
FT   CDS             complement(786651..788324)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07571"
FT                   /product="exopolygalacturonate lyase"
FT                   /EC_number="4.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07571"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27424"
FT                   /db_xref="GOA:E7B9B6"
FT                   /db_xref="InterPro:IPR010702"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B6"
FT                   /protein_id="CBY27424.1"
FT                   /translation="MVMDFIGNIKGSDAVMINWLSAIRSYVDLVQCVSHSNQNPTPLMA
FT                   DGFDVLTHQPVVWKFPDGRNVPISNFASQQNWLRTLDALSLVTQDPQYHQQARVQSSYF
FT                   MQHGVHEQSGLFYWGGHRFFNLDTLKTEGPESKAQVHELKHHLPYYDLLLSVDREKTLN
FT                   FLQGFWHAHVEDWQTLDLGRHGSYDKQRDPHVFTHARHDVVKPQALPQLPETKGLTFVN
FT                   AGTDLIYAAYKYAEYTGDIAAAAWGKHLYRQYVLARNPETGLPVYQFSSPQQRRPIPED
FT                   DNQTQSWYGDRAKRQFGPEFGEIAREANVLFRDMRPLLIDNPLAMLDILRQQPDAEVLQ
FT                   WVIDGLKNYYRFAYDVESNTLRPLWNDGQDMSGYVLQRDGYYGAKGKIISPFPLEVDYL
FT                   LPLVRAWRASEDDELLDLIAVLVQRWQLAELNKQQRSAALMDGKKPAASPYLLLALVEL
FT                   AEHCQCSQLFALAWQIGNDLFQQHYHHGLFVESAEHRYFRIDNPIALAILTLIAAKQNK
FT                   LAAIPQFITNGGYIHGDYRVNGESRTLYDIDFIYPTLLNQ"
FT   CDS             complement(788409..788552)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07581"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27423"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B5"
FT                   /protein_id="CBY27423.1"
FT                   /translation="MPFLLLIYQMVNKHIFTKNLAKTAKIKNSKQRSDSDHTFVIRPMT
FT                   RQ"
FT   CDS             complement(788646..789407)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07591"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07591"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27422"
FT                   /db_xref="GOA:E7B9B4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B4"
FT                   /protein_id="CBY27422.1"
FT                   /translation="MILDSFELKGKIALVTGCDTGLGQGMAIGLAEAGCDIVGVNIVEP
FT                   KETIEKVTALGRRFLSLTADLSKIDGIPALLERAIAEFGQIDILVNNAGIIRREDAINF
FT                   SEKDWDDVMNVNIKTVFFMSQAVAKQFIKQGTGGKIINVASMLSYQGGIRVPSYTASKS
FT                   AVMGVTRLLANEWAKHGINVNAVAPGYMATNNTQQLRKDEERSKEILDRIPAGRWGLPD
FT                   DLKGPVVFLASKASDYISGYTIAVDGGWLAR"
FT   CDS             complement(789519..790355)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07601"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07601"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27421"
FT                   /db_xref="GOA:E7B9B3"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027447"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B3"
FT                   /protein_id="CBY27421.1"
FT                   /translation="MQIRQSIHSDHARQLDTAGLRREFLIENIFVSDEYTMTYSHIDRI
FT                   IVGGILPVEKTVSIGDEVGKQLGVSYFLERRELGVINIGGPGLITVDGQVYEIGNEEAL
FT                   YVGKGAKEVTFNSLESSKSAKFYYNSAPAHTTYPNKKITLAEAAPQTLGDDATSNRRTI
FT                   NKYIVPDVLPTCQLTMGLTKLAPGNLWNTMPCHTHDRRMEVYFYFDMDEETAVFHMMGQ
FT                   AQETRHLLVHNEQAVISPSWSIHSGVGTKRYTFIWGMVGENQVFGDMDHIAVSELR"
FT   CDS             790593..790925
FT                   /transl_table=11
FT                   /locus_tag="Y11_07611"
FT                   /product="pectin degradation protein KdgF"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07611"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27420"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025499"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B2"
FT                   /protein_id="CBY27420.1"
FT                   /translation="MKMFFINDETPWEELGNGIKRKVMTWSDDLMMVCVHFDKGAIGAA
FT                   HKHDIHDQIAYVAAGSFEVEIEGQKRILKAGDAYRAVKNEMHGAVSLEDNSILIDTFNP
FT                   KRDDFL"
FT   CDS             complement(791036..791701)
FT                   /transl_table=11
FT                   /locus_tag="Y11_07621"
FT                   /product="2-deoxyglucose-6-phosphate hydrolase YniC"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07621"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27419"
FT                   /db_xref="GOA:E7B9B1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B1"
FT                   /protein_id="CBY27419.1"
FT                   /translation="MATPHAIKAAIFDMDGLLIDSEPLWLQAELDIFTELGLDTSSRDS
FT                   LPDTLGLRIDLVVKLWFQSMPWQGPSQAEVCKRIIARAIDLVEETKPVLPGVEYALELC
FT                   RTQGLKIGLASASPLHMQKHVLAMLNIEKYFDRLVSAEYLPHSKPHPEVYLNAASDLGV
FT                   DPLECVTLEDSVNGMIATKAARMRSIVIPSVEYRADPRWVLADIQLESLEQLRKEDIS"
FT   CDS             791951..792505
FT                   /transl_table=11
FT                   /locus_tag="Y11_07631"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07631"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27418"
FT                   /db_xref="InterPro:IPR025229"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9B0"
FT                   /protein_id="CBY27418.1"
FT                   /translation="MTYQQAGRVAIIKRIAGWLVFIPALLSTLISIINFAYQYSQKSTG
FT                   INAVMLDFIHVMTDMIRFNTTFLDIFWYNSPMPDFEQGFSASNIMFFIIYMLIFVGLSL
FT                   QASGARMSRQVRHIREGIEDQMILEQAKGSEGRSREQLEAKIVLPHHTIFLQFFTLYIL
FT                   PLVIGVVFYFVIKLLGLMAQE"
FT   CDS             792738..793604
FT                   /transl_table=11
FT                   /locus_tag="Y11_07641"
FT                   /product="lysr family transcriptional regulator YnfL"
FT                   /db_xref="EnsemblGenomes-Gn:Y11_07641"
FT                   /db_xref="EnsemblGenomes-Tr:CBY27417"
FT                   /db_xref="GOA:E7B9A9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E7B9A9"
FT                   /protein_id="CBY27417.1"
FT                   /translation="MRNFIILAQTNSMAKAAEKLHMTASPFGKSIAALEELVGYALFTR
FT                   NEKSISLNKAGQELYQELFPIYQRLSAIDNTIVSLSQRQKNIVIGIDNTYPTIIFDQLF
FT