Dbfetch

ID   FR719748; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   FR719748;
XX
DT   31-JAN-2011 (Rel. 107, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*KZ145new, exons 2-3, isolate KZ145
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Momynaliev K.;
RT   ;
RL   Submitted (08-NOV-2010) to the INSDC.
RL   Momynaliev K., Open Biotechnology Lab, National Center for Biotechnology,
RL   Valikhanov 13/1, Astana 010000, Kazakhstan.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01681.x.
RX   PUBMED; 21732918.
RA   Kuranov A.B., Mukhamedyarov D.A., Momynaliev K.T.;
RT   "Characterization of new HLA-A and -B alleles from Kazakhstan";
RL   Tissue Antigens 78(3):217-218(2011).
XX
DR   MD5; 56f40ce5f01eb3715c1bbfc6f11710d8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /isolate="KZ145"
FT                   /mol_type="genomic DNA"
FT                   /country="Kazakhstan"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*KZ145new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*23:33"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:E8ZF54"
FT                   /protein_id="CBX87030.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFYSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*KZ145new"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*KZ145new"
FT                   /number=3
XX
SQ   Sequence 788 BP; 108 A; 165 C; 194 G; 79 T; 242 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttctac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngttctcac accctccaga tgatgtttgg       540
     ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac caccagtacg cctacgacgg       600
     caaggattac atcgccctga aagaggacct gcgctcttgg accgcggcgg acatggcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcagttga gagcctacct       720
     ggagggcacg tgcgtggacg ggctccgcag atacctggag aacgggaagg agacgctgca       780
     gcgcacgg                                                                788
//