spacer

EBI Dbfetch

ID   FR718797; SV 1; circular; genomic DNA; STD; PRO; 1337 BP.
XX
AC   FR718797;
XX
PR   Project:PRJEA59689;
XX
DT   27-APR-2011 (Rel. 108, Created)
DT   27-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Yersinia enterocolitica W22703 biovar 2, serovar O:9, contig 7180000002017
XX
KW   .
XX
OS   Yersinia enterocolitica W22703
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-1337
RA   Rattei T.;
RT   ;
RL   Submitted (02-NOV-2010) to the INSDC.
RL   Rattei T., Department of Computational Systems Biology, University of
RL   Vienna, Althanstr. 14, 1090 Vienna, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-12-168.
RX   PUBMED; 21453472.
RA   Fuchs T.M., Brandt K., Starke M., Rattei T.;
RT   "Shotgun sequencing of Yersinia enterocolitica strain W22703 (biotype 2,
RT   serotype O:9): genomic evidence for oscillation between invertebrates and
RT   mammals";
RL   BMC Genomics 12:168-168(2011).
XX
DR   MD5; 5b3fe92b5ee56a1f3b591d732607bb68.
DR   EuropePMC; PMC3079665; 21453472.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1337
FT                   /organism="Yersinia enterocolitica W22703"
FT                   /ecotype="Biovar 2"
FT                   /mol_type="genomic DNA"
FT                   /serovar="O:9"
FT                   /note="contig 7180000002017"
FT                   /db_xref="taxon:913028"
FT   CDS             complement(131..790)
FT                   /transl_table=11
FT                   /locus_tag="YEW_HE31070"
FT                   /product="UPF0082 protein YE2395"
FT                   /db_xref="GOA:F4N883"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:F4N883"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:A1JRK5"
FT                   /protein_id="CBX74291.1"
FT                   /translation="MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGA
FT                   NPRLRAAIDKALSNNMTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSD
FT                   NRNRTVSEVRHAFTKTGGNLGTDGSVSYLFTKKGVISYAPGLEEDAVMDAALEAGADDI
FT                   VVYDDGAIDVFTAWESLGAVKDALDATGLVAEGAESLLFHQPKPNLMQKLHQNCCV"
FT   CDS             complement(817..1179)
FT                   /transl_table=11
FT                   /gene="nudB"
FT                   /locus_tag="YEW_HE31080"
FT                   /product="dihydroneopterin triphosphate pyrophosphatase"
FT                   /db_xref="GOA:F4N884"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:F4N884"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0AFC0"
FT                   /protein_id="CBX74292.1"
FT                   /translation="MILIFWQSVTGSLEGDETPLETAQREVKEEVGIDILGENLELFDC
FT                   QRCVEFELFVHLRRRYAPGVTRNKEHWFCLALPEERDVVITEHLAYQWLDAADAAALTK
FT                   SWSNQQAIEEYVLYSV"
XX
SQ   Sequence 1337 BP; 340 A; 373 C; 285 G; 339 T; 0 other;
     ccttacaata tcgagtcgtc gaggtttgtc agcagtctga cactgactta cagtgttgct        60
     gccacttcat cagagatttc accattgtgg taaacctctt gcacatcatc agagtcttcc       120
     agcatatcaa ttagacgcag cagttttggt gcagtttctg catcaagttc ggctttggtt       180
     gatggaataa gagagactca gcgccttcgg caaccagacc ggtagcatcc agtgcatctt       240
     tcaccgcgcc gagagattcc caggcagtaa acacatcaat agcgccatca tcatagacca       300
     cgatatcatc agcgcccgct tccagtgctg catccatcac tgcatcttct tccaaacccg       360
     gtgcatagga aataacacct tttttggtga atagataaga aaccgaacca tcagtcccca       420
     gattaccacc ggttttggtg aatgcatggc gaacttcaga tacggtacgg ttacggttat       480
     cacttaagca ttcaaccatt acggcagtgc cgcctgggcc atagccttcg taaatgatgg       540
     tttccatatt gttatcttca tcacccccca caccacgggc aatggcgcgg ttcagggtat       600
     cgcgcgtcat gttatttgac agcgctttat cgatagcggc acgtaatcgg gggttggcac       660
     caggatcacc accgcccaga cgtgcagcag tcaccaactc acgaataatt ttagtgaaaa       720
     tcttaccgcg cttggcatcc tgtgccgctt tgcggtgttt tgtgttggcc catttactat       780
     gacctgccat aaatcagtat ctccaaaata gtctaactag actgaataaa gaacgtactc       840
     ttcaatcgct tgctgattac tccaggactt ggtcagtgct gcggcatccg cagcatctag       900
     ccactggtaa gcaagatgtt cggtaatcac aacatcccgc tcttcgggta acgccaaaca       960
     gaaccaatgt tctttattgc gcgtaacacc cggcgcatag cgacggcgca aatgcacaaa      1020
     gagttcaaat tccacacagc gctggcagtc gaacagctcc agattttcac ccagtatatc      1080
     aatgccgact tcttccttta cttcgcgctg ggcggtttcc aacggcgttt catcaccttc      1140
     cagactgccg gtgaccgact gccaaaaaat caggatcatc acgccgttgt aacatcaaca      1200
     cccggccact gtttctggcg tagatcaccg ccaaaataga ctctgggcgc ttatacccat      1260
     catctttcaa actacaggtg tgttggctgc gctcaagcat ccgaatcact taccgatgta      1320
     agctcatcgg aataatc                                                     1337
//


spacer
spacer