spacer

EBI Dbfetch

ID   FR717135; SV 1; linear; genomic DNA; STD; HUM; 3198 BP.
XX
AC   FR717135;
XX
DT   31-OCT-2010 (Rel. 106, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*68new, exons
DE   1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3198
RA   Witter K.;
RT   ;
RL   Submitted (25-OCT-2010) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01657.x.
RX   PUBMED; 21438859.
RA   Witter K., Kutsch M., Zahn R., Volgger A., Dick A.;
RT   "Sequence-based typing confirmed a new HLA-A allele, A*68:71";
RL   Tissue Antigens 78(1):69-70(2011).
XX
DR   MD5; a6439923a9440e797fcd715950a5c53b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3198
FT                   /organism="Homo sapiens"
FT                   /isolate="LabCode 203398"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(132..204,335..604,846..1121,1722..1997,2097..2213,
FT                   2652..2684,2827..2874,3044..3048)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:E3Q1L4"
FT                   /db_xref="IMGT/HLA:A*68:71"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E3Q1L4"
FT                   /protein_id="CBX51211.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            132..204
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=1
FT   intron          205..334
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=1
FT   exon            335..604
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=2
FT   intron          605..845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=2
FT   exon            846..1121
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=3
FT   intron          1122..1721
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=3
FT   exon            1722..1997
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=4
FT   intron          1998..2096
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=4
FT   exon            2097..2213
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=5
FT   intron          2214..2651
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=5
FT   exon            2652..2684
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=6
FT   intron          2685..2826
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=6
FT   exon            2827..2874
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=7
FT   intron          2875..3043
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=7
FT   exon            3044..3048
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=8
XX
SQ   Sequence 3198 BP; 621 A; 913 C; 990 G; 674 T; 0 other;
     tcacgacgcg gacccagttc tcactcccat tgggtgtcgg gtttccagag aagccaatca        60
     gtgtcgtcgc ggtcgcggtt ctaaagtccg cacgcaccca ccgggactca gattctcccc       120
     agacgccgag gatggccgtc atggcgcccc gaaccctcgt cctgctactc tcgggggccc       180
     tggccctgac ccagacctgg gcgggtgagt gcggggtcgg gagggaaacg gcctctgtgg       240
     ggagaagcaa ggggcccgcc cggcgggggc gcaggacccg ggaagccgcg cctggaggag       300
     ggtcgggcgg gtctcagcca ctcctcgccc ccaggctccc actccatgag gtatttcttc       360
     acatccgtgt cccggcccgg ccgcggggag ccccgcttca tcgccgtggg ctacgtggac       420
     gacacgcagt tcgtgcggtt cgacagcgac gccgcgagcc agaggatgga gccgcgggcg       480
     ccgtggatag agcaggaggg gccggagtat tgggaccgga acacacggaa tgtgaaggcc       540
     cagtcacaga ctgaccgagt ggacctgggg accctgcgcg gctactacaa ccagagcgag       600
     gccggtgagt gaccccggcc cggggcgcag gtcacgaccc ctcatccccc acggacgggc       660
     caggtcgccc acagtctccg ggtccgagat ccgccccgaa gccgcgggac cccgagaccc       720
     ttgccccggg agaggcccag gcgcctttac ccggtttcat tttcagttta ggccaaaaat       780
     ccccccgggt tggtcggggc ggggcggggc tcgggggacc gggctgacct cggggtccgg       840
     gccaggttct cacaccatcc agatgatgta tggctgcgac gtggggtcgg acgggcgctt       900
     cctccgcggg taccggcagg acgcctacga cggcaaggat tacatcgccc tgaaagagga       960
     cctgcgctct tggaccgcgg cggacatggc agctcagacc accaagcaca agtgggaggc      1020
     ggcccatgtg gcggagcagt ggagagccta cctggagggc acgtgcgtgg agtggctccg      1080
     cagatacctg gagaacggga aggagacgct gcagcgcacg ggtaccaggg gccacggggc      1140
     gcctccctga tcgcctgtag atctcccggg ctggcctccc acaaggaggg gagacaattg      1200
     ggaccaacac tagaatatcg ccctccctct ggtcctgagg gagaggaatc ctcctgggtt      1260
     tccagatcct gtaccagaga gtgactctga ggttccgccc tgctctctga cacaattaag      1320
     ggataaaatc tctgaaggaa tgacgggaag acgatccctc gaatactgat gagtggttcc      1380
     ctttgacaca cacaggcagc agccttgggc ccgtgacttt tcctctcagg ccttgttctc      1440
     tgcttcacac tcaatgtgtg tgggggtctg agtccagcac ttctgagtcc ctcagcctcc      1500
     actcaggtca ggaccagaag tcgctgttcc ctcttcaggg actagaattt tccacggaat      1560
     aggagattat cccaggtgcc tgtgtccagg ctggtgtctg ggttctgtgc tcccttcccc      1620
     atcccaggtg tcctgtccat tctcaagata gccacatgtg tgctggagga gtgtcccatg      1680
     acagatgcaa aatgcctgaa tgatctgact cttcctgaca gacgccccca aaacgcatat      1740
     gactcaccac gctgtctctg accatgaagc caccctgagg tgctgggccc tgagcttcta      1800
     ccctgcggag atcacactga cctggcagcg ggatggggag gaccagaccc aggacacgga      1860
     gctcgtggag accaggcctg caggggatgg aaccttccag aagtgggtgg ctgtggtggt      1920
     gccttctgga caggagcaga gatacacctg ccatgtgcag catgagggtt tgcccaagcc      1980
     cctcaccctg agatggggta aggagggaga cgggggtgtc atgtctttta gggaaagcag      2040
     gagcctctct gacctttagc agggtcaggg cccctcacct tcccctcttt tcccagagcc      2100
     gtcttcccag cccaccatcc ccatcgtggg catcattgct ggcctggttc tctttggagc      2160
     tgtgatcact ggagctgtgg tcgctgctgt gatgtggagg aggaagagct caggtgggga      2220
     aggggtgaag ggtgggtctg agatttcttg tctcactgag ggttccaaga cccaggtaga      2280
     agtgtgccct gcctcgttac tgggaagcac cacccacaat tatgggccta cccagcctgg      2340
     gccctgtgtg ccagcactta ctcttttgta aagcacctgt taaaatgaag gacagattta      2400
     tcaccttgat tacagcggtg atgggacctg atcccagcag tcacaagtca caggggaagg      2460
     tccctgagga ccttcaggag ggcggttggt ccaggaccca cacctgcttt cttcatgttt      2520
     cctgatcccg ccctgggtct gcagtcacac atttctggaa acttctctga ggtccaagac      2580
     ttggaggttc ctctaggacc ttaaggccct gactcctttc tggtatctca caggacattt      2640
     tcttcccaca gatagaaaag gagggagcta ctctcaggct gcaagtaagt atgaaggagg      2700
     ctgatgcctg aggtccttgg gatattgtgt ttgggagccc atgggggagc tcacccaccc      2760
     cacaattcct cctctagcca catcttctgt gggatctgac caggttctgt ttttgttcta      2820
     ccccaggcag tgacagtgcc cagggctctg atgtgtctct cacagcttgt aaaggtgaga      2880
     gcctggaggg cctgatgtgt gttgggtgtt gggcagaaca gtggacacag ctgtgctatg      2940
     gggtttcttt ccattggatg tattgagcat gcgatgggct gtttaaagtg tgacccctca      3000
     ctgtgacaga tacgaatttg ttcatgaata tttttttcta tagtgtgaga cagctgcctt      3060
     gtgtgggact gagaggcaag agttgttcct gcccttccct ttgtgacttg aagaaccctg      3120
     actttgtttc tgcaaaggca cctgcatgtg tctgtgttcg tgtaggcata atgtgaggag      3180
     gtggggagac caccccac                                                    3198
//


spacer
spacer