Dbfetch

ID   FR714926; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FR714926;
XX
DT   15-OCT-2010 (Rel. 106, Created)
DT   15-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*07_6null, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Masson D.M.;
RT   ;
RL   Submitted (13-OCT-2010) to the INSDC.
RL   Masson D.M., HLA Laboratory, EFS Rhone Alpes, BP35, 38701, FRANCE.
XX
RN   [2]
RA   Masson D.;
RT   "x";
RL   Unpublished.
XX
DR   MD5; 9a273568149945aa9e8803069d464479.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' LEU C15, fwd_seq:
FT                   tggcgccccgaaccctcc, rev_name: P3' IN4C, rev_seq:
FT                   cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..254
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07_6null"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E3Q0Y6"
FT                   /db_xref="IMGT/HLA:C*07:164N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:E3Q0Y6"
FT                   /protein_id="CBX36135.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGY"
FT   exon            <1..254
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07_6null"
FT                   /number=2
XX
SQ   Sequence 1022 BP; 170 A; 260 C; 283 G; 109 T; 200 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctaaaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcagnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaacc cccaaagaca cacgtgaccc accaccccct       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga       960
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      1020
     gg                                                                     1022
//