spacer

EBI Dbfetch

ID   FR714916; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FR714916;
XX
DT   15-OCT-2010 (Rel. 106, Created)
DT   15-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele HLA-C*02_3,
DE   exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Masson D.M.;
RT   ;
RL   Submitted (13-OCT-2010) to the INSDC.
RL   Masson D.M., HLA Laboratory, EFS Rhone Alpes, BP35, 38701, FRANCE.
XX
RN   [2]
RA   Masso D.;
RT   "x";
RL   Unpublished.
XX
DR   MD5; 6babfcb8657b1f0be842979b3b0696f5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' LeuC15, fwd_seq:
FT                   tggcgccccgaaccctcc, rev_name: P3' IN4C, rev_seq:
FT                   cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..>822)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02_3"
FT                   /product="MHC class I antigen"
FT                   /function="peptide presentatio"
FT                   /db_xref="GOA:E3Q0X6"
FT                   /db_xref="IMGT/HLA:C*02:02:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E3Q0X6"
FT                   /protein_id="CBX36125.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALG"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02_3"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02_3"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..>822
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02_3"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 177 A; 252 C; 283 G; 110 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acagcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatcccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctacccta cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acgtgccatg tgcagcacga ggggctgcca gagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer