spacer

EBI Dbfetch

ID   FR714837; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FR714837;
XX
DT   11-NOV-2010 (Rel. 106, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA_DPB1*new, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Rojo C.R.;
RT   ;
RL   Submitted (11-OCT-2010) to the INSDC.
RL   Rojo C.R., Internal Medicine, UTHSC at Houston, Medical School, 6431
RL   Fannin, MSB 5.616, Texas, 77030, USA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01695.x.
RX   PUBMED; 21615336.
RA   Rojo C., Charles J., Nguyen N., Reveille J., Mayes M.;
RT   "Identification of a novel HLA-DPB1 allele, DPB1*131:01, by sequence-based
RT   typing";
RL   Tissue Antigens 78(3):222-223(2011).
XX
DR   MD5; f0c1150aec46d4f77c6a9f4fe2cf7b27.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..264,365..>646)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E5AXX6"
FT                   /db_xref="IMGT/HLA:DPB1*131:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E5AXX6"
FT                   /protein_id="CBX32807.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   gap             265..364
FT                   /estimated_length=unknown
FT   exon            365..646
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 130 A; 149 C; 173 G; 94 T; 100 other;
     agaattacgt gcaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggacta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnntccagc ctaaggtgaa cgtttccccc tccaagaagg ggcccctgca gcaccacaac       420
     ctgcttgtct gccacgtgac agatttctac ccaggcagca ttcaagtccg atggttcctg       480
     aatggacagg aggaaacagc tggggtcgtg tccaccaacc tgatccgtaa tggagactgg       540
     accttccaga tcctggtgat gctggaaatg accccccagc agggagacgt ctacatctgc       600
     caagtggagc acaccagcct ggacagtcct gtcaccgtgg agtgga                      646
//


spacer
spacer