Dbfetch

ID   FR714834; SV 1; linear; genomic DNA; STD; HUM; 1419 BP.
XX
AC   FR714834;
XX
DT   13-OCT-2010 (Rel. 106, Created)
DT   13-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*05New, exons 1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1419
RA   Tourne S.;
RT   ;
RL   Submitted (11-OCT-2010) to the INSDC.
RL   Tourne S., EFS Alsace, Laboratoire d histocompatibilite, 10 rue Spielmann,
RL   67065 Strasbourg Cedex, FRANCE.
XX
RN   [2]
RA   Perrier P., Froelich N., Weschler B., Schell A., Leisenbach R., Behr S.,
RA   Tourne S., Hanau D.;
RT   "The new HLA-C*05 allele has a nucleotide change from HLA-C*05:08 (a A to
RT   G) at position 601 (exon 3), which induces the substitution of the
RT   amino-acid at position 177 (a Lys to a Glu). The new HLA-C*05 allele has a
RT   nucleotide change from HLA-C*05:09 (a C to T) at position 538 (exon 3),
RT   which induces the substitution of the amino-acid at position 156 (a Arg to
RT   a Trp)";
RL   Unpublished.
XX
DR   MD5; 8641043a624f8c886e5d5ee773189671.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1419
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /PCR_primers="fwd_name: Glyc-9*3 (intron 1), fwd_seq:
FT                   mtcctgctgctctcgggagc, rev_name: Intron 4C (Intron 4),
FT                   rev_seq: cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..27,158..427,674..949,1144..>1419)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*05:52"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E3Q0Q8"
FT                   /protein_id="CBX32752.1"
FT                   /translation="LALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFD
FT                   SDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQ
FT                   RMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQ
FT                   WRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEIT
FT                   LTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLR
FT                   W"
FT   exon            <1..27
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=1
FT   intron          28..157
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=1
FT   exon            158..427
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=2
FT   intron          428..673
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=2
FT   exon            674..949
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=3
FT   intron          950..1143
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=3
FT   gap             978..1077
FT                   /estimated_length=unknown
FT   exon            1144..>1419
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05New"
FT                   /number=4
XX
SQ   Sequence 1419 BP; 252 A; 414 C; 469 G; 184 T; 100 other;
     ccctggccct gaccgagacc tgggcctgtg agtgcgaggt tgggagggaa acggcctctg        60
     cggagaggag cgaggggccc gcccggcgag ggcgcaggac ccggggagcc gcgcagggag       120
     gagggtcggg cgggtctcag cccctcctcg cccccaggct cccactccat gaggtatttc       180
     tacaccgccg tgtcccggcc cggccgcgga gagccccgct tcatcgcagt gggctacgtg       240
     gacgacacgc agttcgtgca gttcgacagc gacgccgcga gtccaagagg ggagccgcgg       300
     gcgccgtggg tggagcagga ggggccggag tattgggacc gggagacaca gaagtacaag       360
     cgccaggcac agactgaccg agtgaacctg cggaaactgc gcggctacta caaccagagc       420
     gaggccggtg agtgaccccg gcccggggcg caggtcacga cccctcccca tcccccacgg       480
     acggcccggg tcgccccgag tctcccggtc tgagatccac cccgaggctg cggaacccgc       540
     ccagaccctc gaccggagag agccccagtc acctttaccc ggtttcattt tcagtttagg       600
     ccaaaatccc cgcgggttgg tcggggctgg ggcggggctc gggggacggg gctgaccacg       660
     ggggcggggc cagggtctca caccctccag aggatgtatg gctgcgacct ggggcccgac       720
     gggcgcctcc tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg       780
     aatgaggacc tgcgctcctg gaccgccgcg gacaaggcgg ctcagatcac ccagcgcaag       840
     tgggaggcgg cccgtgaggc ggagcagtgg agagcctacc tggagggcac gtgcgtggag       900
     tggctccgca gatacctgga gaacgggaag gagacgctgc agcgcgcggg taccaggggc       960
     agtggggagc cttccccnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnatg      1080
     ggcgctgttg gagtgtcgca agagagatac aaagtgtctg aattttctga ctcttcccgt      1140
     cagaacaccc aaagacacac gtgacccacc atcccgtctc tgaccatgag gccaccctga      1200
     ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag cgggatggcg      1260
     aggaccaaac tcaggacacc gagcttgtgg agaccaggcc agcaggagat ggaaccttcc      1320
     agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacacg tgccatgtgc      1380
     agcacgaggg gctgccagag cccctcaccc tgagatggg                             1419
//