Dbfetch

ID   FR695061; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FR695061;
XX
DT   05-OCT-2010 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II, allele HLA-DPB1*20new,
DE   exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Bengtsson M.;
RT   ;
RL   Submitted (04-OCT-2010) to the INSDC.
RL   Bengtsson M., Dep. of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "New HLA DP1 variant found in an unrelated donor";
RL   Unpublished.
XX
DR   MD5; 04e2fbe5c845a42e52268577e5f0d595.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*20new"
FT                   /product="MHC class II"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1Y7U4"
FT                   /db_xref="IMGT/HLA:DPB1*130:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1Y7U4"
FT                   /protein_id="CBX25819.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNWEEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDLLEEKRAVPDRMCRHNYELDEAVTLQRR"
FT   exon            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*20new"
FT                   /number=2
XX
SQ   Sequence 264 BP; 63 A; 63 C; 96 G; 42 T; 0 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac tgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggacta ctggaacagc cagaaggacc       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//