Dbfetch

ID   FR694190; SV 1; linear; genomic DNA; STD; HUM; 1021 BP.
XX
AC   FR694190;
XX
DT   29-SEP-2010 (Rel. 106, Created)
DT   29-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*01new, exons 2-4, isolate DEHA704064AN
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1021
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (28-SEP-2010) to the INSDC.
RL   McWhinnie A.J., Anthony Nolan Research Institute, HLA Group, Fleet Road,
RL   Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Mcwhinnie A.J.M., Wallis-Jones S.;
RT   "A new HLA-A allele A*01XX undetected by serological HLA typing, differing
RT   from A*01:01:01:01 with a G deletion at position 723 resulting in an
RT   altered reading frame beginning codon 217 leading to premature stop at
RT   codon 272";
RL   Unpublished.
XX
DR   MD5; 2d0292d16df4a0336f8551d0f1e6c4ba.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1021
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="DEHA704064AN"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01new"
FT                   /number=2
FT   CDS             join(<3..270,371..646,747..1015)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*01:87N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:E1Y6U1"
FT                   /protein_id="CBX25013.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTCSGMGRT
FT                   RPRTRSSWRPGLQGMEPSRSGRLWWCLLERSRDTPAMCSMRVCPSPSP"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01new"
FT                   /number=4
XX
SQ   Sequence 1021 BP; 171 A; 251 C; 282 G; 117 T; 200 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg       540
     gaggcggtcc atgcggcgga gcagcggaga gtctacctgg agggccggtg cgtggacggg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca catatgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgc agcgggatgg ggaggaccag acccaggaca cggagctcgt ggagaccagg       900
     cctgcagggg atggaacctt ccagaagtgg gcggctgtgg tggtgccttc tggagaggag       960
     cagagataca cctgccatgt gcagcatgag ggtctgccca agcccctcac cctgagatgg      1020
     g                                                                      1021
//